Q9D9T8 · EFHC1_MOUSE
- ProteinEF-hand domain-containing protein 1
- GeneEfhc1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids648 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating (PubMed:37295417, PubMed:37865089, PubMed:37989994).
Microtubule-associated protein which regulates cell division and neuronal migration during cortical development (By similarity).
Necessary for radial and tangential cell migration during brain development, possibly acting as a regulator of cell morphology and process formation during migration (By similarity).
May enhance calcium influx through CACNA1E and stimulate programmed cell death (By similarity).
Overexpression of EFHC1 in hippocampal primary culture neurons induced apoptosis (PubMed:15258581).
Microtubule-associated protein which regulates cell division and neuronal migration during cortical development (By similarity).
Necessary for radial and tangential cell migration during brain development, possibly acting as a regulator of cell morphology and process formation during migration (By similarity).
May enhance calcium influx through CACNA1E and stimulate programmed cell death (By similarity).
Overexpression of EFHC1 in hippocampal primary culture neurons induced apoptosis (PubMed:15258581).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axonemal A tubule inner sheath | |
Cellular Component | axonemal microtubule | |
Cellular Component | axoneme | |
Cellular Component | centrosome | |
Cellular Component | cilium | |
Cellular Component | mitotic spindle | |
Cellular Component | neuronal cell body | |
Cellular Component | sperm flagellum | |
Cellular Component | spindle pole | |
Molecular Function | alpha-tubulin binding | |
Molecular Function | calcium ion binding | |
Biological Process | cilium-dependent cell motility | |
Biological Process | flagellated sperm motility | |
Biological Process | intracellular calcium ion homeostasis | |
Biological Process | mitotic cytokinesis | |
Biological Process | mitotic spindle organization | |
Biological Process | positive regulation of apoptotic process | |
Biological Process | regulation of cell division |
Names & Taxonomy
Protein names
- Recommended nameEF-hand domain-containing protein 1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9D9T8
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000073878 | 1-648 | EF-hand domain-containing protein 1 | |||
Sequence: MGTNPVHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRRPTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLRKEPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPELPAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSYKENLRETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLCTHGEGRINYYNFVRAFSN |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in adult brain including hippocampus, cerebellum, cerebral cortex, thalamus, hypothalamus, amygdala and upper brainstem. Expressed in soma and dentrites of pyramidal neurons of the hippocampal CA1 region, pyramidal neurons of the cerebral cortex and Purkinje cells of cerebellum. Highly expressed in testis, trachea, and oviduct, moderately in lung, and slightly in brain. Highly expressed in sperm flagella and tracheal cilia (at protein level).
Interaction
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-45 | Required for its localization in the mitotic spindle and interaction with alpha-tubulin | ||||
Sequence: MGTNPVHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRRPTM | ||||||
Domain | 93-198 | DM10 1 | ||||
Sequence: DKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQG | ||||||
Domain | 239-359 | DM10 2 | ||||
Sequence: DKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKF | ||||||
Domain | 416-520 | DM10 3 | ||||
Sequence: DNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNA | ||||||
Domain | 582-617 | EF-hand | ||||
Sequence: SYKENLRETFQMYDKDESGYVDRETFFKICETLNVP |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length648
- Mass (Da)75,142
- Last updated2001-06-01 v1
- ChecksumBBA3377AADB9D373
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B2CKC6 | B2CKC6_MOUSE | Efhc1 | 648 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK006489 EMBL· GenBank· DDBJ | BAB24614.1 EMBL· GenBank· DDBJ | mRNA |