Q9D9T0 · DYDC1_MOUSE
- ProteinDPY30 domain-containing protein 1
- GeneDydc1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids175 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia (PubMed:36417862).
Plays a crucial role during acrosome biogenesis (PubMed:19545932).
Plays a crucial role during acrosome biogenesis (PubMed:19545932).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | 9+2 motile cilium | |
Cellular Component | extracellular region | |
Cellular Component | radial spoke | |
Cellular Component | Set1C/COMPASS complex | |
Cellular Component | sperm flagellum | |
Biological Process | epithelial cilium movement involved in extracellular fluid movement | |
Biological Process | flagellated sperm motility | |
Biological Process | mating |
Names & Taxonomy
Protein names
- Recommended nameDPY30 domain-containing protein 1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9D9T0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000247557 | 1-175 | DPY30 domain-containing protein 1 | |||
Sequence: MESRYLQKCLGTCLTQGLTEVARVRPLDPIEYLAFWLYKHKENMNMEQMRQREMITLEHERELAMMEQEMLERLKAEELLFQQQLAFQLELEMQQKEKQKSEDFETGQEKSFKSMMSMESTARGEEQEPMQAEELVMDSGKTLAEISDRYGAPNLSRVEELDEPMLSDNGVSAPP |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of the axonemal radial spoke complex 1 (RS1), at least composed of spoke head proteins RSPH1, RSPH3, RSPH9 and the cilia-specific component RSPH4A or sperm-specific component RSPH6A, spoke stalk proteins RSPH14, DNAJB13, DYDC1, ROPN1L and NME5, and the anchor protein IQUB (PubMed:36417862).
Interacts with SH3GL3 (By similarity).
Interacts with SH3GL3 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 94-109 | Basic and acidic residues | ||||
Sequence: QQKEKQKSEDFETGQE | ||||||
Region | 94-134 | Disordered | ||||
Sequence: QQKEKQKSEDFETGQEKSFKSMMSMESTARGEEQEPMQAEE | ||||||
Region | 152-175 | Disordered | ||||
Sequence: APNLSRVEELDEPMLSDNGVSAPP |
Sequence similarities
Belongs to the dpy-30 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9D9T0-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length175
- Mass (Da)20,494
- Last updated2012-10-03 v2
- Checksum45EAB6A38F877069
Q9D9T0-2
- Name2
- Differences from canonical
- 69-84: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E0CXB0 | E0CXB0_MOUSE | Dydc1 | 177 |
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_020012 | 69-84 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 94-109 | Basic and acidic residues | ||||
Sequence: QQKEKQKSEDFETGQE | ||||||
Sequence conflict | 152 | in Ref. 1; BAB24626 | ||||
Sequence: A → E |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK006511 EMBL· GenBank· DDBJ | BAB24626.1 EMBL· GenBank· DDBJ | mRNA | ||
AC154597 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466573 EMBL· GenBank· DDBJ | EDL24916.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC049632 EMBL· GenBank· DDBJ | AAH49632.1 EMBL· GenBank· DDBJ | mRNA |