Q9D938 · TM160_MOUSE
- ProteinTransmembrane protein 160
- GeneTmem160
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids188 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion |
Names & Taxonomy
Protein names
- Recommended nameTransmembrane protein 160
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9D938
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 102-122 | Helical | ||||
Sequence: FFLLGGLCVVWGGASYAVGLA | ||||||
Transmembrane | 135-155 | Helical | ||||
Sequence: AAAGVGAVLAASLLWACAVGL |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Homozygous knockout mice for Tmem160 are healthy and fertile and display normal motor function regarding coordination and locomotion as well as similar somatosensory thresholds for mechanical (tactile) and heat stimulation as wild-type littermates (PubMed:34936870).
Homozygous knockout male mice show a delay establishment of tactile hypersensitivity and alterations in selfgrooming after nerve injury (PubMed:34936870).
Conditional knockout mice lacking Tmem160 in sensory neurons of dorsal root ganglia (DRG) are healthy and fertile (PubMed:34936870).
Homozygous knockout male mice show a delay establishment of tactile hypersensitivity and alterations in selfgrooming after nerve injury (PubMed:34936870).
Conditional knockout mice lacking Tmem160 in sensory neurons of dorsal root ganglia (DRG) are healthy and fertile (PubMed:34936870).
Variants

We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-96 | Mitochondrion | ||||
Sequence: MGGGWWWARVARLARLRFRGSLQPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHETAFLSWFRNGLLSSGIGVISFMQSDMGR | ||||||
Modified residue | 48 | Phosphoserine | ||||
Sequence: S | ||||||
Chain | PRO_0000277811 | 97-188 | Transmembrane protein 160 | |||
Sequence: EAAYGFFLLGGLCVVWGGASYAVGLAALRGPMQLSLAGAAAGVGAVLAASLLWACAVGLYMGQLELDVELVPEDDGAASTEGPDEAGRPPPE |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in peripheral sensory neurons of dorsal root ganglia (DRG).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 21-53 | Disordered | ||||
Sequence: SLQPPQRPRSGGARGSFAPGHGPRAGASPPPVS | ||||||
Region | 168-188 | Disordered | ||||
Sequence: PEDDGAASTEGPDEAGRPPPE |
Sequence similarities
Belongs to the TMEM160 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length188
- Mass (Da)19,587
- Last updated2001-06-01 v1
- Checksum834F25801CF27607
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1B0GR84 | A0A1B0GR84_MOUSE | Tmem160 | 70 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK007386 EMBL· GenBank· DDBJ | BAB25003.1 EMBL· GenBank· DDBJ | mRNA | ||
AK166985 EMBL· GenBank· DDBJ | BAE39166.1 EMBL· GenBank· DDBJ | mRNA | ||
BC028534 EMBL· GenBank· DDBJ | AAH28534.1 EMBL· GenBank· DDBJ | mRNA |