Q9D6K5 · SYJ2B_MOUSE
- ProteinSynaptojanin-2-binding protein
- GeneSynj2bp
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids145 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Isoform 1 regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction. Isoform 2 and isoform 3 show a stimulatory affect on activin-induced signal transduction and enhance activin type 2 expression at the cell surface.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSynaptojanin-2-binding protein
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9D6K5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion outer membrane ; Single-pass type IV membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-117 | Cytoplasmic | ||||
Sequence: MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGCAVSLRVQHRLPVQNGPIVHRGEGEPSG | ||||||
Transmembrane | 118-138 | Helical; Anchor for type IV membrane protein | ||||
Sequence: VPVAMVLLPVFALTMVAVWAF | ||||||
Topological domain | 139-145 | Mitochondrial intermembrane | ||||
Sequence: VRYRKQL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000375982 | 1-145 | Synaptojanin-2-binding protein | |||
Sequence: MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGCAVSLRVQHRLPVQNGPIVHRGEGEPSGVPVAMVLLPVFALTMVAVWAFVRYRKQL |
Proteomic databases
PTM databases
Expression
Tissue specificity
Isoform 1 and isoform 2 are widely expressed, notably in brain, heart, lung, liver, kidney, skeletal muscle, ovary and testis. Isoform 3 is detected only in heart, spleen and testis.
Induction
Up-regulated between 12 and 24 hours after treatment with activin A and lipopolysaccharide (LPS). Down-regulated by calcium ionophore A23187.
Gene expression databases
Interaction
Subunit
Binds (via the PDZ domain) to isoform 2A of SYNJ2 (via the unique motif in the C-terminus) (By similarity).
Interacts (via C-terminus) with RALBP1. Interacts (via PDZ domain) with ACVR2A (via C-terminus) and ACVR2B (via C-terminus). Forms a ternary complex with ACVR2A and RALBP1 (PubMed:11882656, PubMed:16648306).
Interacts with MAPK12 (By similarity).
Interacts with DLL1; enhances DLL1 protein stability, and promotes notch signaling in endothelial cells (By similarity).
Interacts (via C-terminus) with RALBP1. Interacts (via PDZ domain) with ACVR2A (via C-terminus) and ACVR2B (via C-terminus). Forms a ternary complex with ACVR2A and RALBP1 (PubMed:11882656, PubMed:16648306).
Interacts with MAPK12 (By similarity).
Interacts with DLL1; enhances DLL1 protein stability, and promotes notch signaling in endothelial cells (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9D6K5 | Lrp2 A2ARV4 | 2 | EBI-300910, EBI-300875 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 13-100 | PDZ | ||||
Sequence: EINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGCAVSLRVQHRL |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q9D6K5-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length145
- Mass (Da)15,815
- Last updated2001-06-01 v1
- ChecksumBB40BB0114084F67
Q9D6K5-2
- Name2
Q9D6K5-3
- Name3
Q9D6K5-4
- Name4
- Differences from canonical
- 101-145: PVQNGPIVHRGEGEPSGVPVAMVLLPVFALTMVAVWAFVRYRKQL → LVVGGSFGLREFSQIRYDAVTIKIDPELEKKLKVNKITLESEYERLLCLLCRQ
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_053101 | 1-20 | in isoform 3 | |||
Sequence: MNGRVDYLVTEEEINLTRGP → MIF | ||||||
Sequence conflict | 34 | in Ref. 4; BAB25432 | ||||
Sequence: Q → E | ||||||
Alternative sequence | VSP_053102 | 100-118 | in isoform 2 and isoform 3 | |||
Sequence: LPVQNGPIVHRGEGEPSGV → VGITCTWIWDSRLLHCSCE | ||||||
Alternative sequence | VSP_053103 | 101-145 | in isoform 4 | |||
Sequence: PVQNGPIVHRGEGEPSGVPVAMVLLPVFALTMVAVWAFVRYRKQL → LVVGGSFGLREFSQIRYDAVTIKIDPELEKKLKVNKITLESEYERLLCLLCRQ | ||||||
Alternative sequence | VSP_053104 | 119-145 | in isoform 2 and isoform 3 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF414433 EMBL· GenBank· DDBJ | AAM43958.1 EMBL· GenBank· DDBJ | mRNA | ||
AY071903 EMBL· GenBank· DDBJ | AAL60065.1 EMBL· GenBank· DDBJ | mRNA | ||
AY157057 EMBL· GenBank· DDBJ | AAO12271.1 EMBL· GenBank· DDBJ | mRNA | ||
AY138960 EMBL· GenBank· DDBJ | AAN17786.1 EMBL· GenBank· DDBJ | mRNA | ||
AY566156 EMBL· GenBank· DDBJ | AAT70239.1 EMBL· GenBank· DDBJ | mRNA | ||
AK008054 EMBL· GenBank· DDBJ | BAB25432.1 EMBL· GenBank· DDBJ | mRNA | ||
AK013474 EMBL· GenBank· DDBJ | BAB28873.1 EMBL· GenBank· DDBJ | mRNA | ||
AK033514 EMBL· GenBank· DDBJ | BAC28333.1 EMBL· GenBank· DDBJ | mRNA | ||
AK163362 EMBL· GenBank· DDBJ | BAE37317.1 EMBL· GenBank· DDBJ | mRNA | ||
BC027433 EMBL· GenBank· DDBJ | AAH27433.2 EMBL· GenBank· DDBJ | mRNA | Different initiation |