Q9D350 · OBOX1_MOUSE
- ProteinOocyte-specific homeobox protein 1
- GeneObox1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids204 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Transcription factor required for zygotic genome activation (ZGA), a critical event in early embryonic development during which the developmental control passes from maternally provided mRNAs to the expression of the zygotic genome after fertilization (PubMed:37459895).
Together with other Obox family members, required in early two-cell stage embryos to kick-start the major ZGA wave by facilitating RNA Polymerase II 'pre-configuration', during which RNA Polymerase II relocates from the initial one-cell stage binding targets to ZGA gene promoters and distal enhancers (PubMed:37459895).
Mechanistically, promotes recruitment of RNA Polymerase II from (CG-rich) non-ZGA genes to (CG-poor) ZGA genes at the two-cell stage (PubMed:37459895).
Binds to regulatory DNA sequences containing a 5'-ACNCCTTTAATCCCAG-3' sequence motif (PubMed:37459895).
Most maternal and zygotic Obox family proteins can compensate for one another (PubMed:37459895).
In addition to its role in ZGA, promotes embryonic stem cell pluripotency (PubMed:29033306).
Together with other Obox family members, required in early two-cell stage embryos to kick-start the major ZGA wave by facilitating RNA Polymerase II 'pre-configuration', during which RNA Polymerase II relocates from the initial one-cell stage binding targets to ZGA gene promoters and distal enhancers (PubMed:37459895).
Mechanistically, promotes recruitment of RNA Polymerase II from (CG-rich) non-ZGA genes to (CG-poor) ZGA genes at the two-cell stage (PubMed:37459895).
Binds to regulatory DNA sequences containing a 5'-ACNCCTTTAATCCCAG-3' sequence motif (PubMed:37459895).
Most maternal and zygotic Obox family proteins can compensate for one another (PubMed:37459895).
In addition to its role in ZGA, promotes embryonic stem cell pluripotency (PubMed:29033306).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 94-153 | Homeobox | ||||
Sequence: FRKERTVYTKEQQGLLQKHFDECQYPNKKKIVELALSVGVTKREIKIWFKNNRAKYRRMN |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | maternal-to-zygotic transition of gene expression | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | stem cell population maintenance |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameOocyte-specific homeobox protein 1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9D350
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype; mice are viable and fertile (PubMed:37459895).
Female mice lacking maternally transcribed Obox1, Obox2, Obox5, Obox7 as well as zygotically expressed Obox3 and Obox4 are infertile: embryos arrest at two-four cell stage due to impaired zygotic genome activation (ZGA) (PubMed:37459895).
Female mice lacking maternally transcribed Obox1, Obox2, Obox5, Obox7 as well as zygotically expressed Obox3 and Obox4 are infertile: embryos arrest at two-four cell stage due to impaired zygotic genome activation (ZGA) (PubMed:37459895).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 45 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000459210 | 1-204 | Oocyte-specific homeobox protein 1 | |||
Sequence: MAEGPSLHPKLQVDSNIPIEISSQIPQEPARNLAFQMRQSPLVTPGSTTKSSLSVPERNLLKQESQGPSRQSGCMLLSDKYVNKQTGPMASRKFRKERTVYTKEQQGLLQKHFDECQYPNKKKIVELALSVGVTKREIKIWFKNNRAKYRRMNLQNIEQVLPESNGSSKAVSESTHFPVVASDNGESMCSGTFGEDSIPKFNCS |
Proteomic databases
Expression
Tissue specificity
Specifically expressed in oocytes and early embryos.
Developmental stage
Expressed maternally with high expression in oocytes and early embryos before expression declines after zygotic genome activation (ZGA).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 28-73 | Disordered | ||||
Sequence: EPARNLAFQMRQSPLVTPGSTTKSSLSVPERNLLKQESQGPSRQSG |
Sequence similarities
Belongs to the paired homeobox family. Obox subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length204
- Mass (Da)22,875
- Last updated2001-06-01 v1
- Checksum61148C6988DC35C3
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0AA74J9U6 | A0AA74J9U6_MOUSE | Obox1 | 188 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF461106 EMBL· GenBank· DDBJ | AAL68800.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK018362 EMBL· GenBank· DDBJ | BAB31178.1 EMBL· GenBank· DDBJ | mRNA | ||
AK136061 EMBL· GenBank· DDBJ | BAE22803.1 EMBL· GenBank· DDBJ | mRNA | ||
BC141323 EMBL· GenBank· DDBJ | AAI41324.1 EMBL· GenBank· DDBJ | mRNA | ||
BC141324 EMBL· GenBank· DDBJ | AAI41325.1 EMBL· GenBank· DDBJ | mRNA |