Q9CY57 · CHTOP_MOUSE
- ProteinChromatin target of PRMT1 protein
- GeneChtop
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids249 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays an important role in the ligand-dependent activation of estrogen receptor target genes (By similarity).
May play a role in the silencing of fetal globin genes (PubMed:20688955).
Recruits the 5FMC complex to ZNF148, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed:22872859).
Required for the tumorigenicity of glioblastoma cells. Binds to 5-hydroxymethylcytosine (5hmC) and associates with the methylosome complex containing PRMT1, PRMT5, MEP50 and ERH. The CHTOP-methylosome complex associated with 5hmC methylates H4R3 and transactivates genes involved in glioblastomagenesis (PubMed:25284789).
May play a role in the silencing of fetal globin genes (PubMed:20688955).
Recruits the 5FMC complex to ZNF148, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed:22872859).
Required for the tumorigenicity of glioblastoma cells. Binds to 5-hydroxymethylcytosine (5hmC) and associates with the methylosome complex containing PRMT1, PRMT5, MEP50 and ERH. The CHTOP-methylosome complex associated with 5hmC methylates H4R3 and transactivates genes involved in glioblastomagenesis (PubMed:25284789).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nuclear speck | |
Cellular Component | nucleolus | |
Cellular Component | nucleus | |
Molecular Function | methyl-CpG binding | |
Molecular Function | mRNA binding | |
Biological Process | chromatin remodeling | |
Biological Process | in utero embryonic development | |
Biological Process | mRNA export from nucleus |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameChromatin target of PRMT1 protein
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9CY57
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Mostly associated with facultative heterochromatin. Localizes to regions surrounding nuclear speckles known as perispeckles in which TREX complex assembly seems to occur (By similarity).
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000089264 | 2-249 | Chromatin target of PRMT1 protein | |||
Sequence: AAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND | ||||||
Modified residue | 40 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 49 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 64 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 70 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 243 | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
Asymmetrically methylated by PRMT1. Symmetrically methylated by PRMT5.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Broadly expressed with highest levels found in thymus, spleen, and lymph nodes. Expressed in an erythroid progenitor cell line derived from fetal liver.
Developmental stage
Broadly expressed at 16.5 dpc.
Gene expression databases
Interaction
Subunit
Interacts with PRMT1 and PRMT5 (PubMed:19858291, PubMed:22872859).
Interacts with the 5FMC complex; the interaction is methylation-dependent. Interacts with FYTTD1, SET and PRC1 complex members CBX4, RNF2 and PHC2; the interactions are methylation-independent. Interacts with ZNF148 (PubMed:22872859).
Interacts with WDR77 and ERH (By similarity).
Interacts with the 5FMC complex; the interaction is methylation-dependent. Interacts with FYTTD1, SET and PRC1 complex members CBX4, RNF2 and PHC2; the interactions are methylation-independent. Interacts with ZNF148 (PubMed:22872859).
Interacts with WDR77 and ERH (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9CY57 | Prmt1 Q9JIF0 | 8 | EBI-6393116, EBI-519055 | |
BINARY | Q9CY57 | Prmt5 Q8CIG8 | 4 | EBI-6393116, EBI-2527009 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 152-205 | Disordered | ||||
Sequence: LRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRG | ||||||
Region | 154-207 | Interaction with PRMT1 | ||||
Sequence: RGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGAL | ||||||
Motif | 195-204 | GAR motif; involved in 5hmC binding | ||||
Sequence: GRGRGRGRGR |
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 5 isoforms produced by Alternative splicing.
Q9CY57-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length249
- Mass (Da)26,585
- Last updated2003-03-01 v2
- Checksum5F3E44A53ED0645F
Q9CY57-2
- Name2
- NoteMay be due to an intron retention.
- Differences from canonical
- 1-25: Missing
Q9CY57-3
- Name3
Q9CY57-4
- Name4
Q9CY57-5
- Name5
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E9PW20 | E9PW20_MOUSE | Chtop | 203 | ||
D3YZA1 | D3YZA1_MOUSE | Chtop | 123 | ||
D3Z7T7 | D3Z7T7_MOUSE | Chtop | 195 | ||
A0AA74KT39 | A0AA74KT39_MOUSE | Chtop | 269 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_011743 | 1-25 | in isoform 2, isoform 4 and isoform 5 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_011744 | 74 | in isoform 3 and isoform 5 | |||
Sequence: Missing | ||||||
Sequence conflict | 96 | in Ref. 2; BAE31263 | ||||
Sequence: L → Q | ||||||
Alternative sequence | VSP_011745 | 137-182 | in isoform 3, isoform 4 and isoform 5 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB041654 EMBL· GenBank· DDBJ | BAA95102.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK004558 EMBL· GenBank· DDBJ | BAB23371.1 EMBL· GenBank· DDBJ | mRNA | ||
AK005377 EMBL· GenBank· DDBJ | BAB23984.2 EMBL· GenBank· DDBJ | mRNA | ||
AK008885 EMBL· GenBank· DDBJ | BAB25951.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK010866 EMBL· GenBank· DDBJ | BAB27232.2 EMBL· GenBank· DDBJ | mRNA | ||
AK047914 EMBL· GenBank· DDBJ | BAC33189.1 EMBL· GenBank· DDBJ | mRNA | ||
AK077960 EMBL· GenBank· DDBJ | BAC37084.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK132769 EMBL· GenBank· DDBJ | BAE21348.1 EMBL· GenBank· DDBJ | mRNA | ||
AK149010 EMBL· GenBank· DDBJ | BAE28718.1 EMBL· GenBank· DDBJ | mRNA | ||
AK152492 EMBL· GenBank· DDBJ | BAE31263.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466547 EMBL· GenBank· DDBJ | EDL15130.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC083333 EMBL· GenBank· DDBJ | AAH83333.1 EMBL· GenBank· DDBJ | mRNA | ||
BC120651 EMBL· GenBank· DDBJ | AAI20652.1 EMBL· GenBank· DDBJ | mRNA |