Q9CR75 · TNR12_MOUSE
- ProteinTumor necrosis factor receptor superfamily member 12A
- GeneTnfrsf12a
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids129 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Receptor for TNFSF12/TWEAK (By similarity).
Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins
Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell surface | |
Cellular Component | plasma membrane | |
Cellular Component | ruffle | |
Biological Process | angiogenesis | |
Biological Process | cell adhesion | |
Biological Process | cell differentiation | |
Biological Process | extrinsic apoptotic signaling pathway | |
Biological Process | positive regulation of axon extension | |
Biological Process | positive regulation of extrinsic apoptotic signaling pathway | |
Biological Process | regulation of angiogenesis | |
Biological Process | substrate-dependent cell migration, cell attachment to substrate |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTumor necrosis factor receptor superfamily member 12A
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9CR75
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 28-80 | Extracellular | ||||
Sequence: EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWP | ||||||
Transmembrane | 81-101 | Helical | ||||
Sequence: ILGGALSLVLVLALVSSFLVW | ||||||
Topological domain | 102-129 | Cytoplasmic | ||||
Sequence: RRCRRREKFTTPIEETGGEGCPGVALIQ |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-27 | |||||
Sequence: MASAWPRSLPQILVLGFGLVLMRAAAG | ||||||
Chain | PRO_0000034612 | 28-129 | Tumor necrosis factor receptor superfamily member 12A | |||
Sequence: EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWPILGGALSLVLVLALVSSFLVWRRCRRREKFTTPIEETGGEGCPGVALIQ | ||||||
Disulfide bond | 36↔49 | |||||
Sequence: CSSGSSWSADLDKC | ||||||
Disulfide bond | 52↔67 | |||||
Sequence: CASCPARPHSDFCLGC | ||||||
Disulfide bond | 55↔64 | |||||
Sequence: CPARPHSDFC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in fetal heart, intestine, kidney, liver, lung and skin, and in adult heart and ovary. Intermediate expression in adult kidney, lung and skin.
Induction
By FGF-1.
Gene expression databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length129
- Mass (Da)13,641
- Last updated2001-06-01 v1
- Checksum1665C68B4D9A9253
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E9PZT5 | E9PZT5_MOUSE | Tnfrsf12a | 94 | ||
A0A3B2W7Y2 | A0A3B2W7Y2_MOUSE | Tnfrsf12a | 139 | ||
A0A3B2W475 | A0A3B2W475_MOUSE | Tnfrsf12a | 83 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 3-4 | in Ref. 1; AAF07882 | ||||
Sequence: SA → PG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF156164 EMBL· GenBank· DDBJ | AAF07882.1 EMBL· GenBank· DDBJ | mRNA | ||
AK005382 EMBL· GenBank· DDBJ | BAB23989.1 EMBL· GenBank· DDBJ | mRNA | ||
AK005530 EMBL· GenBank· DDBJ | BAB24101.1 EMBL· GenBank· DDBJ | mRNA | ||
AK160136 EMBL· GenBank· DDBJ | BAE35650.1 EMBL· GenBank· DDBJ | mRNA | ||
BC025860 EMBL· GenBank· DDBJ | AAH25860.1 EMBL· GenBank· DDBJ | mRNA |