Q9CQM5 · TXD17_MOUSE
- ProteinThioredoxin domain-containing protein 17
- GeneTxndc17
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids123 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide (By similarity).
Features
Showing features for active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 43 | Nucleophile | ||||
Sequence: C | ||||||
Site | 44 | Contributes to redox potential value | ||||
Sequence: P | ||||||
Site | 45 | Contributes to redox potential value | ||||
Sequence: D | ||||||
Active site | 46 | Nucleophile | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | peroxidase activity | |
Molecular Function | protein-disulfide reductase (NAD(P)H) activity | |
Biological Process | tumor necrosis factor-mediated signaling pathway |
Names & Taxonomy
Protein names
- Recommended nameThioredoxin domain-containing protein 17
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ9CQM5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000120023 | 2-123 | Thioredoxin domain-containing protein 17 | |||
Sequence: ATFEEVSVLGFEEFDKAVKEHEGKTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFRQKLKITAVPTLLKYGTPQKLVESECCQSSLVEMIFSED | ||||||
Disulfide bond | 43↔46 | Redox-active | ||||
Sequence: CPDC |
Post-translational modification
The oxidized protein is reduced by TRXR1.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 41-123 | Thioredoxin | ||||
Sequence: SWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFRQKLKITAVPTLLKYGTPQKLVESECCQSSLVEMIFSED |
Sequence similarities
Belongs to the thioredoxin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length123
- Mass (Da)14,015
- Last updated2001-06-01 v1
- Checksum763689BCCAABD8ED
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 22 | in Ref. 2; BAE41434 | ||||
Sequence: H → R | ||||||
Sequence conflict | 24 | in Ref. 2; BAB23225 | ||||
Sequence: G → S | ||||||
Sequence conflict | 40 | in Ref. 1; CAC51438 | ||||
Sequence: K → Q | ||||||
Sequence conflict | 76 | in Ref. 2; BAE41434 | ||||
Sequence: Y → H |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ344103 EMBL· GenBank· DDBJ | CAC51438.1 EMBL· GenBank· DDBJ | mRNA | ||
AK004219 EMBL· GenBank· DDBJ | BAB23225.1 EMBL· GenBank· DDBJ | mRNA | ||
AK007595 EMBL· GenBank· DDBJ | BAB25126.1 EMBL· GenBank· DDBJ | mRNA | ||
AK013103 EMBL· GenBank· DDBJ | BAB28648.1 EMBL· GenBank· DDBJ | mRNA | ||
AK076425 EMBL· GenBank· DDBJ | BAC36336.1 EMBL· GenBank· DDBJ | mRNA | ||
AK169882 EMBL· GenBank· DDBJ | BAE41434.1 EMBL· GenBank· DDBJ | mRNA | ||
BX119911 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC030344 EMBL· GenBank· DDBJ | AAH30344.1 EMBL· GenBank· DDBJ | mRNA |