Q9C9Z9 · ELD1_ARATH
- ProteinGlycosyltransferase-like KOBITO 1
- GeneELD1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids533 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the coordination between cell elongation and cellulose synthesis by promoting the expression of genes involved in cell elongation and cellulose synthesis (PubMed:10859181, PubMed:12215501, PubMed:15010620, PubMed:24995569).
Acts as a regulator of plasmodesmatal permeability (PubMed:22457425).
Mediates abscisic acid (ABA) and sugar responses essential for growth (e.g. seed germination, stomatal regulation and ABA-regulated gene expression) (PubMed:14742875).
Required for normal organogenesis by promoting cell elongation, regulating cell differentiation in vascular tissues and maintaining root meristem identity (PubMed:10859181, PubMed:15010620).
Regulates crystalline cellulose microfibrils deposition and parallel organization during the elongation phase of the cell (PubMed:12215501).
Maybe a glycosyltransferase (PubMed:22457425).
Negative factor in light inhibition of hypocotyl elongation through modulating cellulose biosynthesis (PubMed:24995569).
Acts as a regulator of plasmodesmatal permeability (PubMed:22457425).
Mediates abscisic acid (ABA) and sugar responses essential for growth (e.g. seed germination, stomatal regulation and ABA-regulated gene expression) (PubMed:14742875).
Required for normal organogenesis by promoting cell elongation, regulating cell differentiation in vascular tissues and maintaining root meristem identity (PubMed:10859181, PubMed:15010620).
Regulates crystalline cellulose microfibrils deposition and parallel organization during the elongation phase of the cell (PubMed:12215501).
Maybe a glycosyltransferase (PubMed:22457425).
Negative factor in light inhibition of hypocotyl elongation through modulating cellulose biosynthesis (PubMed:24995569).
Miscellaneous
'Kobito' means 'dwarf' in Japanese.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycosyltransferase-like KOBITO 1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9C9Z9
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Increased plasmodesmatal permeability leading to an increase in intercellular protein trafficking (PubMed:22457425).
Growth-defective due to cellulose deficiency, impaired cell elongation and altered cell division in root meristems, thus leading to stunted plants (PubMed:10859181, PubMed:12215501, PubMed:15010620).
When light-grown, dwarf, with very short root and lateral organs (e.g. leaves) extremely reduced in size, as well as abnormal vascular tissues, characterized by twisted vascular bundle and the presence of undifferentiated vascular cells (PubMed:15010620, PubMed:24995569).
Accumulation of ectopic lignin, especially in the mature part of the root, of ectopic callose accumulation in hypocotyls, and of ectopic suberin around the vascular bundles in roots and hypocotyls (PubMed:10859181, PubMed:12215501, PubMed:15010620).
Photomorphogenesis in the dark, absence of etiolated phenotype, with extremely short hypocotyls, shoot development, and inflorescences and flowers production (PubMed:15010620, PubMed:24995569).
Inability to grow in soil (PubMed:14742875, PubMed:15010620).
The cell wall is constituted by abnormally randomized microfibrils occluded by a layer of pectins probably due to a defect in the synthesis of crystalline cellulose during the elongation phase of the cell (PubMed:15010620, PubMed:24995569).
Abscisic acid- (ABA-) resistant germination associated with defective stomatal regulation, altered ABA-responsive gene expression, delayed flowering, and male sterility (PubMed:14742875).
Glucose- (Glc-) dependent growth with impaired Glc sensitivity that normaly induces seedling developmental arrest; Glc reverses partially disruption phenotypes (PubMed:14742875).
Growth-defective due to cellulose deficiency, impaired cell elongation and altered cell division in root meristems, thus leading to stunted plants (PubMed:10859181, PubMed:12215501, PubMed:15010620).
When light-grown, dwarf, with very short root and lateral organs (e.g. leaves) extremely reduced in size, as well as abnormal vascular tissues, characterized by twisted vascular bundle and the presence of undifferentiated vascular cells (PubMed:15010620, PubMed:24995569).
Accumulation of ectopic lignin, especially in the mature part of the root, of ectopic callose accumulation in hypocotyls, and of ectopic suberin around the vascular bundles in roots and hypocotyls (PubMed:10859181, PubMed:12215501, PubMed:15010620).
Photomorphogenesis in the dark, absence of etiolated phenotype, with extremely short hypocotyls, shoot development, and inflorescences and flowers production (PubMed:15010620, PubMed:24995569).
Inability to grow in soil (PubMed:14742875, PubMed:15010620).
The cell wall is constituted by abnormally randomized microfibrils occluded by a layer of pectins probably due to a defect in the synthesis of crystalline cellulose during the elongation phase of the cell (PubMed:15010620, PubMed:24995569).
Abscisic acid- (ABA-) resistant germination associated with defective stomatal regulation, altered ABA-responsive gene expression, delayed flowering, and male sterility (PubMed:14742875).
Glucose- (Glc-) dependent growth with impaired Glc sensitivity that normaly induces seedling developmental arrest; Glc reverses partially disruption phenotypes (PubMed:14742875).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 371 | In kob1-3; increased plasmodesmatal permeability, dwarf plants and stomata clusters in the erl1-2 erl2-1 background. | ||||
Sequence: S → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 15 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, glycosylation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-43 | |||||
Sequence: MKSTHHHRAPLISASSSSSSSSQNHSFVSRLLLLLTLLPVSLA | ||||||
Glycosylation | 24 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Chain | PRO_0000430755 | 44-533 | Glycosyltransferase-like KOBITO 1 | |||
Sequence: CLAFILQWRGGGLADPASASVRSSTSVPGGSDLNHEVFPGMETVSSVSPKSHQSSSDCSNLARSSSPSFPYYADWKFGVDTSLKPKICITTSTSAGLDQILPWMFYHKVLGVSTFFLFVEGKAATPSISKVLESIPGVKVIYRTKELEEKQAKSRIWNETWLSSFFYKPCNYELFVKQSLNMEMAIVMARDAGMDWILHLDTDELIYPAGAREYSLRRLLLDVPPNVDMVIFPNYESSVERDDIKDPFTEVSMFKKNYDHLPKDTYFGMYKEATRNNPNYFLTYGNGKSVARVQDHLRPNGAHRWHNYMKTPNEIKLEEAAVLHYTYSKFSDLTSRRDRCGCKPTKEDVKRCFMLDFDRSAFIIASTATDEEMLSWYREHVVWGDKDVKTKLLRKGILTRIYSPMVVIQALKESGVFSSVVSSASTNLSKKKFLSSIHKSNSSRSTASESLPSKESKSEGISARHLLEAESAIPPLSPPGMEQARFFTED | ||||||
Glycosylation | 201 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 470 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 484 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at low levels in both light- and dark-grown plants (PubMed:12215501, PubMed:14742875, PubMed:15010620).
Accumulates especially in the elongation zone of roots (at protein level) (PubMed:14742875).
Expressed in the roots regardless of the light treatment, high levels in the uppermost regions of hypocotyls in darkness, but low levels in light-grown hypocotyls (PubMed:24995569).
Accumulates especially in the elongation zone of roots (at protein level) (PubMed:14742875).
Expressed in the roots regardless of the light treatment, high levels in the uppermost regions of hypocotyls in darkness, but low levels in light-grown hypocotyls (PubMed:24995569).
Induction
Down-regulated by light in a phytochrome A-dependent manner, via protein destabilization and subsequent degradation by the 26S proteasome (at protein level). Reduced transcription in light conditions in a HY5-dependent manner.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MKSTHHHRAPLISASSSSSSSS | ||||||
Region | 86-108 | Disordered | ||||
Sequence: TVSSVSPKSHQSSSDCSNLARSS | ||||||
Compositional bias | 87-108 | Polar residues | ||||
Sequence: VSSVSPKSHQSSSDCSNLARSS | ||||||
Domain | 137-377 | GT92 | ||||
Sequence: SAGLDQILPWMFYHKVLGVSTFFLFVEGKAATPSISKVLESIPGVKVIYRTKELEEKQAKSRIWNETWLSSFFYKPCNYELFVKQSLNMEMAIVMARDAGMDWILHLDTDELIYPAGAREYSLRRLLLDVPPNVDMVIFPNYESSVERDDIKDPFTEVSMFKKNYDHLPKDTYFGMYKEATRNNPNYFLTYGNGKSVARVQDHLRPNGAHRWHNYMKTPNEIKLEEAAVLHYTYSKFSDLT | ||||||
Compositional bias | 485-500 | Polar residues | ||||
Sequence: SSRSTASESLPSKESK | ||||||
Region | 485-504 | Disordered | ||||
Sequence: SSRSTASESLPSKESKSEGI | ||||||
Region | 512-533 | Disordered | ||||
Sequence: AESAIPPLSPPGMEQARFFTED |
Sequence similarities
Belongs to the glycosyltransferase 92 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length533
- Mass (Da)59,889
- Last updated2001-06-01 v1
- Checksum06C33FE658F68764
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 87-108 | Polar residues | ||||
Sequence: VSSVSPKSHQSSSDCSNLARSS | ||||||
Compositional bias | 485-500 | Polar residues | ||||
Sequence: SSRSTASESLPSKESK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF543710 EMBL· GenBank· DDBJ | AAN33186.1 EMBL· GenBank· DDBJ | mRNA | ||
AC012562 EMBL· GenBank· DDBJ | AAG51348.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE74645.1 EMBL· GenBank· DDBJ | Genomic DNA |