Q9C9H1 · GIS3_ARATH
- ProteinZinc finger protein GIS3
- GeneGIS3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids244 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin. Acts upstream of GIS, GIS2, ZFP8, and the trichome initiation factors GL1 and GL3. Binds the promoter region of GIS and GIS2, which may be direct targets of GIS3.
Miscellaneous
Plants over-expressing GIS3 have increased trichome densities in sepals, cauline leaves, lateral branches, main inflorescence stems, and have ectopic trichomes on carpels.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | metal ion binding | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | cytokinin-activated signaling pathway | |
Biological Process | gibberellic acid mediated signaling pathway | |
Biological Process | glucosinolate metabolic process | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | trichome morphogenesis |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameZinc finger protein GIS3
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9C9H1
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Decreased number of trichomes in cauline leaves, lateral branches, sepals and main stems.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 19 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000438923 | 1-244 | Zinc finger protein GIS3 | |||
Sequence: MEELDFSSKTTTSRLKLFGFSVDGEEDFSDQSVKTNLSSVSPERGEFPAGSSGRSGGGVRSRGGGGGGGERKYECQYCCREFGNSQALGGHQNAHKKERQQLKRAQLQATRNAAANFSNAGSASQFLRNPIVSAFAPPPHLLSSSAVPQPMGGPWMYLPRVSPSQLHVSHGCVIQDGSGGAGAGGFSYEYGARDSGFGVVGAQMRHVQAHGPRPSVNGFSREVGTTFDDGLGLDLHLSLAPAGH |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9C9H1 | BBX26 O80748 | 3 | EBI-15194063, EBI-15191535 | |
BINARY | Q9C9H1 | TCP10 O82277 | 3 | EBI-15194063, EBI-3133327 | |
BINARY | Q9C9H1 | TCP14 Q93Z00 | 3 | EBI-15194063, EBI-4424563 | |
BINARY | Q9C9H1 | TCP15 Q9C9L2 | 3 | EBI-15194063, EBI-4426144 | |
BINARY | Q9C9H1 | TCP19 Q9LT89 | 4 | EBI-15194063, EBI-4426178 | |
BINARY | Q9C9H1 | TCP9 O64647 | 3 | EBI-15194063, EBI-9838721 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 26-69 | Disordered | ||||
Sequence: EDFSDQSVKTNLSSVSPERGEFPAGSSGRSGGGVRSRGGGGGGG | ||||||
Zinc finger | 73-95 | C2H2-type | ||||
Sequence: YECQYCCREFGNSQALGGHQNAH |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length244
- Mass (Da)25,600
- Last updated2001-06-01 v1
- ChecksumF869A3CFD94DF0CA
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC016447 EMBL· GenBank· DDBJ | AAG52593.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE34785.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT029451 EMBL· GenBank· DDBJ | ABK59680.1 EMBL· GenBank· DDBJ | mRNA | ||
AB493526 EMBL· GenBank· DDBJ | BAH30364.1 EMBL· GenBank· DDBJ | mRNA |