Q9C8U5 · IAN2_ARATH
- ProteinImmune-associated nucleotide-binding protein 2
- GeneIAN2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids234 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | plasma membrane | |
Molecular Function | GTP binding | |
Biological Process | cellular response to heat | |
Biological Process | endoplasmic reticulum unfolded protein response |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameImmune-associated nucleotide-binding protein 2
- Short namesAtIAN2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9C8U5
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000438026 | 1-234 | Immune-associated nucleotide-binding protein 2 | |||
Sequence: MGTSVSKPVSDDKKKGTSVSKPVKNIVLVGRSVNGICTTGNNILGQNKFGSEGAFMHCQMYSTTTPDGQMINVIKTPGMFDLSVSEDYISKEIINCLTLAEEGVHAVLFVLSMKNRITQEEEYALNTLQRIFGSKILEYLIFLLIDGEKFEAKEFEDYFPECCPEFLMRVLRFCNGRKVLFNNMTNDEGVKAEQVNQVMAHVAAISKKNDEKPYTEDMYRNIKVNTFFSLIAFI |
Proteomic databases
Expression
Tissue specificity
Mostly expressed in pollen. Also detected in lateral roots and radicles.
Induction
Up-regulated by brassinolides. Down-regulated by 2-aminoethoxyvinylglycine (AVG), high CO2, isoxaben, and propiconazole treatments.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 21-223 | AIG1-type G | ||||
Sequence: KPVKNIVLVGRSVNGICTTGNNILGQNKFGSEGAFMHCQMYSTTTPDGQMINVIKTPGMFDLSVSEDYISKEIINCLTLAEEGVHAVLFVLSMKNRITQEEEYALNTLQRIFGSKILEYLIFLLIDGEKFEAKEFEDYFPECCPEFLMRVLRFCNGRKVLFNNMTNDEGVKAEQVNQVMAHVAAISKKNDEKPYTEDMYRNIK |
Sequence similarities
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. AIG1/Toc34/Toc159-like paraseptin GTPase family. IAN subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length234
- Mass (Da)26,378
- Last updated2001-06-01 v1
- Checksum84D9D7204A23473A
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC022288 EMBL· GenBank· DDBJ | AAG52216.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE31636.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | ANM57911.1 EMBL· GenBank· DDBJ | Genomic DNA |