Q9C895 · BRE1B_ARATH
- ProteinE3 ubiquitin-protein ligase BRE1-like 2
- GeneHUB2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids900 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6.
Miscellaneous
HUB1 and HUB2 are involved in the same processes, but are weakly or not redundant.
Catalytic activity
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | metal ion binding | |
Molecular Function | protein homodimerization activity | |
Molecular Function | ubiquitin-protein transferase activity | |
Biological Process | chromatin organization | |
Biological Process | innate immune response | |
Biological Process | leaf morphogenesis | |
Biological Process | protein ubiquitination | |
Biological Process | seed dormancy process | |
Biological Process | vegetative to reproductive phase transition of meristem |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameE3 ubiquitin-protein ligase BRE1-like 2
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9C895
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Plants have reduced seed dormancy and several pleiotropic phenotypes, including alterations in leaf color, plant architecture and flower morphology.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 45 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000293109 | 1-900 | E3 ubiquitin-protein ligase BRE1-like 2 | |||
Sequence: MENQESDEPMQKKPHLLDSVSPNSMARNSSPSHPIAKSVSFFDCDFSLLCLRLVDYEIDVDATVLQLQNQKLVQQLDLQKKQLYDVESKIQELQLNQTSYDDELISVNQLWNQLVDDLILLGVRAGANQEALNYLDIVDKKRVPPCAADETFLCRLLQVDSLDTSKSDEVVRKVEEALALRHSSTMELMGLFENTIDTQKTKAESISQSLHAVKSTEDATIQLSSINDLMKEESKNLREMIDALHVRHKEHSEQIQAYISSHSTDQSELKHLKGQLEEIKAELEENRRKLITLKMQKDAACEGHVTSPAIANGSLSPEKPVDKTKLRELKDSIDEIKIMAEGRLSELQASQEYNLSLSRQCQDIENELKDDQYIYSSRLYSLINDRIHHWNAELDRYKILTEAIQAERSFVMRRDKELNLRAESLEAANHKTTTVGSRIEVLEKKLQSCIIEKNGLELETEEAIQDSERQDIKSEFIAMASTLSKEMEMMEAQLKRWKDTAQDALYLREQAQSLRVSLSNKADEQKGLEDKCAKQMAEIKSLKALIEKLLKEKLQLQNLASICTRECNDDRGLAEIKDSQRKAQAQAEELKNVLDEHFLELRVKAAHETESACQERLATAKAEIAELRTQLDLSEREVLELKEGIKVKEQEAEASIAEMETIGQAYEDMQTQNQHLLQQVAERDDYNIKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKARIAHNEEQMKGCFSEAYKLIQEDRHLVISLETTKWEVADADKEFRWLKSAVSSSEKEYEQISRRTDDIKLELDDERREKKKLEEELMELNKELEELGSESVEAAIVRLQEEVKNCKNILKCGVCFDRPKEVVIVKCYHLFCQQCIQRSLEIRHRKCPGCGTAFGQNDVRLVKM |
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitously expressed.
Developmental stage
Constant throughout the cell cycle.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, coiled coil, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-31 | Disordered | ||||
Sequence: MENQESDEPMQKKPHLLDSVSPNSMARNSSP | ||||||
Compositional bias | 17-31 | Polar residues | ||||
Sequence: LDSVSPNSMARNSSP | ||||||
Coiled coil | 63-96 | |||||
Sequence: TVLQLQNQKLVQQLDLQKKQLYDVESKIQELQLN | ||||||
Coiled coil | 217-300 | |||||
Sequence: EDATIQLSSINDLMKEESKNLREMIDALHVRHKEHSEQIQAYISSHSTDQSELKHLKGQLEEIKAELEENRRKLITLKMQKDAA | ||||||
Coiled coil | 437-660 | |||||
Sequence: SRIEVLEKKLQSCIIEKNGLELETEEAIQDSERQDIKSEFIAMASTLSKEMEMMEAQLKRWKDTAQDALYLREQAQSLRVSLSNKADEQKGLEDKCAKQMAEIKSLKALIEKLLKEKLQLQNLASICTRECNDDRGLAEIKDSQRKAQAQAEELKNVLDEHFLELRVKAAHETESACQERLATAKAEIAELRTQLDLSEREVLELKEGIKVKEQEAEASIAEME | ||||||
Coiled coil | 706-737 | |||||
Sequence: SEKQVMEKQLHQVNASVENFKARIAHNEEQMK | ||||||
Zinc finger | 848-887 | RING-type | ||||
Sequence: CGVCFDRPKEVVIVKCYHLFCQQCIQRSLEIRHRKCPGCG |
Domain
The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme.
Sequence similarities
Belongs to the BRE1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9C895-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length900
- Mass (Da)103,396
- Last updated2009-09-01 v2
- Checksum6F42D8C355815CF2
Q9C895-2
- Name2
- NoteMay be due to an intron retention.
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8APW2 | A0A1P8APW2_ARATH | HUB2 | 881 | ||
F4I079 | F4I079_ARATH | HUB2 | 899 | ||
F4I080 | F4I080_ARATH | HUB2 | 397 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC027034 EMBL· GenBank· DDBJ | AAG51572.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE33210.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE33211.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY085755 EMBL· GenBank· DDBJ | AAM62973.1 EMBL· GenBank· DDBJ | mRNA | ||
BT029207 EMBL· GenBank· DDBJ | ABJ17142.1 EMBL· GenBank· DDBJ | mRNA |