Q9C5Z2 · EIF3H_ARATH
- ProteinEukaryotic translation initiation factor 3 subunit H
- GeneTIF3H1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids337 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation (Potential). Regulates translation initiation of specific 5' mRNAs harboring multiple upstream open reading frames (uORFs) in their 5' leader sequence (e.g. BETA-OHASE 2 and LHY) (PubMed:15548739, PubMed:17439654, PubMed:23524850).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | eukaryotic 43S preinitiation complex | |
Cellular Component | eukaryotic 48S preinitiation complex | |
Cellular Component | eukaryotic translation initiation factor 3 complex | |
Cellular Component | extracellular region | |
Cellular Component | ribosome | |
Molecular Function | metallopeptidase activity | |
Molecular Function | mRNA binding | |
Molecular Function | translation initiation factor activity | |
Biological Process | abscisic acid-activated signaling pathway | |
Biological Process | formation of cytoplasmic translation initiation complex | |
Biological Process | positive regulation of translational initiation | |
Biological Process | response to abscisic acid | |
Biological Process | response to auxin | |
Biological Process | response to glucose | |
Biological Process | response to maltose | |
Biological Process | response to sucrose |
Keywords
- Molecular function
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameEukaryotic translation initiation factor 3 subunit H
- Short nameseIF3h
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ9C5Z2
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Pleiotropic growth defects throughout development including postembryonic growth retardation, and delayed shoot and root growth, flowering, and senescence. Lethal at 80 percent at the vegetative rosettes stage. Reduced fertility. Compromised translation efficiency of specific 5' mRNA leader sequences. Requires exogenous sugar to transit from seedling to vegetative development, but hypersensitive to elevated levels of exogenous sugars (e.g. sucrose, maltose and glucose). Enhanced sensitivity to abscisic acid (ABA) (PubMed:15548739).
Impaired uORF-RNAs polysomal association (PubMed:23524850).
Impaired uORF-RNAs polysomal association (PubMed:23524850).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 178 | Impaired activation of uORF-mRNA translation. | ||||
Sequence: S → A | ||||||
Mutagenesis | 178 | Phosphorylation mimic mutant, up-regulation of uORF-mRNA translation. | ||||
Sequence: S → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 4 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000213963 | 1-337 | Eukaryotic translation initiation factor 3 subunit H | |||
Sequence: MATMARSFLQAISKDEAVAPPLRVVQIEGLAVLKIIKHCKEFSPTLVTGQLLGLDVGSVLEVTNCFPFPVRDDDEEIEADGANYQLEMMRCLREVNVDNNTVGWYQSTVLGSYQTVELIETFMNYQENIKRCVCIIYDPSKADLGVLALKALKLSDSFMELYRGGNFTGEKLREKNFSWMDIFEEIPIKVSNSALVSAFMTELETDTPVSQGDYDRLHSSTTPFLENNMEFLIKCMDDLSMEQQKFQYYYRNLSRQQAQQQAWLQKRRTENMARKSAGEEPLPEEDPSNPIFKAIPEPSRLESFLITNQVSNFCGQINGVAGQNFSRLYLTKALHDN | ||||||
Modified residue | 178 | Phosphoserine; by ATPK1 | ||||
Sequence: S |
Post-translational modification
In response to auxin (NAA), phosphorylated at Ser-178 by ATPK1 and binds to polysomes via TOR signaling. This phosphorylation is repressed by Torin-1.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Mostly expressed in roots and flowers, and, to a lower extent, in leaves, stems and siliques.
Gene expression databases
Interaction
Subunit
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex. Interacts directly with TIF3A1, TIF3B1, TIF3C1, TIF3E1 and TIF3F1 (PubMed:15548739, PubMed:20444226).
Associates with the CSN (COP9 signalosome) complex. Binds to CSN1, CSN7 and CSN8 (PubMed:15548739).
Interacts with ATPK1 (PubMed:23524850).
Associates with the CSN (COP9 signalosome) complex. Binds to CSN1, CSN7 and CSN8 (PubMed:15548739).
Interacts with ATPK1 (PubMed:23524850).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9C5Z2 | ATPK1 P42818 | 3 | EBI-3387106, EBI-8107038 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 25-158 | MPN | ||||
Sequence: VQIEGLAVLKIIKHCKEFSPTLVTGQLLGLDVGSVLEVTNCFPFPVRDDDEEIEADGANYQLEMMRCLREVNVDNNTVGWYQSTVLGSYQTVELIETFMNYQENIKRCVCIIYDPSKADLGVLALKALKLSDSF | ||||||
Region | 267-290 | Disordered | ||||
Sequence: RRTENMARKSAGEEPLPEEDPSNP | ||||||
Compositional bias | 268-282 | Basic and acidic residues | ||||
Sequence: RTENMARKSAGEEPL |
Sequence similarities
Belongs to the eIF-3 subunit H family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9C5Z2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length337
- Mass (Da)38,373
- Last updated2002-09-19 v2
- ChecksumF9965DA546AC977C
Q9C5Z2-2
- Name2
- Differences from canonical
- 1-87: Missing
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_057957 | 1-87 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 146 | in Ref. 1; AAG53614 | ||||
Sequence: V → L | ||||||
Compositional bias | 268-282 | Basic and acidic residues | ||||
Sequence: RTENMARKSAGEEPL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF285833 EMBL· GenBank· DDBJ | AAG53614.1 EMBL· GenBank· DDBJ | mRNA | ||
AC007354 EMBL· GenBank· DDBJ | AAD31329.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE28653.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE28654.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY054641 EMBL· GenBank· DDBJ | AAK96832.1 EMBL· GenBank· DDBJ | mRNA | ||
AY081546 EMBL· GenBank· DDBJ | AAM10108.1 EMBL· GenBank· DDBJ | mRNA | ||
BT000765 EMBL· GenBank· DDBJ | AAN31904.1 EMBL· GenBank· DDBJ | mRNA | ||
AY087338 EMBL· GenBank· DDBJ | AAM64888.1 EMBL· GenBank· DDBJ | mRNA |