Q9BZQ2 · SHP1L_HUMAN
- ProteinTesticular spindle-associated protein SHCBP1L
- GeneSHCBP1L
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids653 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Testis-specific spindle-associated factor that plays a role in spermatogenesis. In association with HSPA2, participates in the maintenance of spindle integrity during meiosis in male germ cells.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | meiotic spindle | |
Biological Process | cell differentiation | |
Biological Process | male meiosis cytokinesis | |
Biological Process | positive regulation of chromosome organization | |
Biological Process | spermatogenesis |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTesticular spindle-associated protein SHCBP1L
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BZQ2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with alpha tubulin during meiosis. Colocalizes with HSPA2 at spindle during the meiosis process.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_031836 | 491 | in dbSNP:rs12138972 | |||
Sequence: V → M |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 831 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000284838 | 1-653 | Testicular spindle-associated protein SHCBP1L | |||
Sequence: MASGSKASVPADSFRTISPDRRGEKSASAVSGDTAAATTLKGTAIPVRSVVASPRPVKGKAGRETARLRLQRLPAAQAEDTGEAAAAAAEEPLLPVPEDEEEAQPLPPVCVSRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLKLKDKWLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPFSSNIANIPRDLVDEILEELEHSVPLLEVYPVEGQDTDIHVIALALEVVRFFYDFLWRDWDDEESCENYTALIEERINLWCDIQDGTIPGPIAQRFKKTLEKYKNKRVELIEYQSNIKEDPSAAEAVECWKKYYEIVMLCGLLKMWEDLRLRVHGPFFPRILRRRKGKREFGKTITHIVAKMMTTEMIKDLSSDTLLQQHGDLDLALDNCYSGDTVIIFPGEYQAANLALLTDDIIIKGVGKREEIMITSEPSRDSFVVSKADNVKLMHLSLIQQGTVDGIVVVESGHMTLENCILKCEGTGVCVLTGAALTITDSEITGAQGAGVELYPGSIAILERNEIHHCNNLRTSNSSKSTLGGVNMKVLPAPKLKMTNNHIYSNKGYGVSILQPMEQFFIVAEEALNKRASSGDKKDDKMLFKVMQNLNLEMNNNKIEANVKGDIRIVTS | ||||||
Modified residue | 8 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 53 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 570 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 645 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with HSPA2; this interaction may promote the recruitment of HSPA2 to the spindle.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BZQ2 | CASP6 P55212 | 3 | EBI-10818532, EBI-718729 | |
BINARY | Q9BZQ2 | HIP1 O00291 | 3 | EBI-10818532, EBI-473886 | |
BINARY | Q9BZQ2 | LAMP2 P13473-2 | 3 | EBI-10818532, EBI-21591415 | |
BINARY | Q9BZQ2 | PRPF40A O75400-2 | 3 | EBI-10818532, EBI-5280197 | |
BINARY | Q9BZQ2 | SH3GLB1 Q9Y371 | 3 | EBI-10818532, EBI-2623095 | |
BINARY | Q9BZQ2 | ZNF835 Q9Y2P0 | 3 | EBI-10818532, EBI-5667516 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-65 | Disordered | ||||
Sequence: MASGSKASVPADSFRTISPDRRGEKSASAVSGDTAAATTLKGTAIPVRSVVASPRPVKGKAGRET | ||||||
Coiled coil | 299-326 | |||||
Sequence: IAQRFKKTLEKYKNKRVELIEYQSNIKE | ||||||
Repeat | 493-514 | PbH1 1 | ||||
Sequence: SGHMTLENCILKCEGTGVCVLT | ||||||
Repeat | 515-537 | PbH1 2 | ||||
Sequence: GAALTITDSEITGAQGAGVELYP | ||||||
Repeat | 538-571 | PbH1 3 | ||||
Sequence: GSIAILERNEIHHCNNLRTSNSSKSTLGGVNMKV | ||||||
Repeat | 574-596 | PbH1 4 | ||||
Sequence: APKLKMTNNHIYSNKGYGVSILQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9BZQ2-3
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name3
- Length653
- Mass (Da)72,632
- Last updated2016-11-30 v3
- Checksum451E8593E0CCE4FA
Q9BZQ2-2
- Name2
Q9BZQ2-4
- Name4
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_024673 | 1-119 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_024676 | 120-135 | in isoform 2 | |||
Sequence: DEKVSLYCDEVLQDCK → MGFLQLVRLDSNSRPQ | ||||||
Alternative sequence | VSP_024677 | 136-149 | in isoform 4 | |||
Sequence: AEDADEVMGKYLSE → KMLMKLWVNTYQKN | ||||||
Alternative sequence | VSP_024678 | 150-653 | in isoform 4 | |||
Sequence: Missing | ||||||
Sequence conflict | 198 | in Ref. 1; AAG60616/AAG60617 | ||||
Sequence: F → L | ||||||
Sequence conflict | 249 | in Ref. 1; AAG60616 | ||||
Sequence: I → L |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF288397 EMBL· GenBank· DDBJ | AAG60616.1 EMBL· GenBank· DDBJ | mRNA | ||
AF288398 EMBL· GenBank· DDBJ | AAG60617.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AF297023 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF297016 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF297017 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF297018 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF297019 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF297020 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF297021 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF297022 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF312863 EMBL· GenBank· DDBJ | AAG45336.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL662837 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL450304 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC026084 EMBL· GenBank· DDBJ | AAH26084.1 EMBL· GenBank· DDBJ | mRNA | ||
BC050305 EMBL· GenBank· DDBJ | AAH50305.1 EMBL· GenBank· DDBJ | mRNA | ||
BC132764 EMBL· GenBank· DDBJ | AAI32765.1 EMBL· GenBank· DDBJ | mRNA |