Q9BZE9 · ASPC1_HUMAN
- ProteinTether containing UBX domain for GLUT4
- GeneASPSCR1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids553 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Enhances VCP methylation catalyzed by VCPKMT
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 311-312 | Breakpoint for translocation to form ASPSCR1-TFE3 | ||||
Sequence: RP |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic side of plasma membrane | |
Cellular Component | cytosol | |
Cellular Component | endomembrane system | |
Cellular Component | endoplasmic reticulum-Golgi intermediate compartment membrane | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | vesicle membrane | |
Biological Process | glucose homeostasis | |
Biological Process | intracellular protein transport | |
Biological Process | positive regulation of protein modification process | |
Biological Process | regulation of glucose import |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTether containing UBX domain for GLUT4
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BZE9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_027503 | 252 | in dbSNP:rs8074498 | |||
Sequence: L → Q | ||||||
Natural variant | VAR_034745 | 318 | in dbSNP:rs34085048 | |||
Sequence: V → M | ||||||
Natural variant | VAR_027504 | 487 | in dbSNP:rs13087 | |||
Sequence: D → E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 756 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylalanine | ||||
Sequence: A | |||||||
Chain | PRO_0000249885 | 2-553 | UniProt | Tether containing UBX domain for GLUT4 | |||
Sequence: AAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPCEYDLKFQRSVLDLSLQWRFANLPNNAKLEMVPASRSREGPENMVRIALQLDDGSRLQDSFCSGQTLWELLSHFPQIRECLQHPGGATPVCVYTRDEVTGEAALRGTTLQSLGLTGGSATIRFVMKCYDPVGKTPGSLGSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSSAKLPKSLSSPGGPSKPKKSKSGQDPQQEQEQERERDPQQEQERERPVDREPVDREPVVCHPDLEERLQAWPAELPDEFFELTVDDVRRRLAQLKSERKRLEEAPLVTKAFREAQIKEKLERYPKVALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLGNPELSFYLFITPPKTVLDDHTQTLFQANLFPAALVHLGAEEPAGVYLEPGLLEHAISPSAADVLVARYMSRAAGSPSPLPAPDPAPKSEPAAEEGALVPPEPIPGTAQPVKRSLGKVPKWLKLPASKR | |||||||
Modified residue (large scale data) | 167 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 184 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 274 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 275 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 275 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 500 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 500 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 502 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 502 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with VCPKMT. Interacts with VCP
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BZE9 | ADAMTSL4 Q6UY14-3 | 3 | EBI-1993677, EBI-10173507 | |
BINARY | Q9BZE9 | CLK2 P49760 | 3 | EBI-1993677, EBI-750020 | |
BINARY | Q9BZE9 | INCA1 Q0VD86 | 3 | EBI-1993677, EBI-6509505 | |
BINARY | Q9BZE9 | KRT31 Q15323 | 3 | EBI-1993677, EBI-948001 | |
BINARY | Q9BZE9 | KRTAP1-1 Q07627 | 3 | EBI-1993677, EBI-11959885 | |
BINARY | Q9BZE9 | KRTAP10-8 P60410 | 3 | EBI-1993677, EBI-10171774 | |
BINARY | Q9BZE9 | NOTCH2NLA Q7Z3S9 | 3 | EBI-1993677, EBI-945833 | |
BINARY | Q9BZE9 | TACC3 Q9Y6A5 | 3 | EBI-1993677, EBI-2554984 | |
BINARY | Q9BZE9 | TCF4 P15884 | 3 | EBI-1993677, EBI-533224 | |
BINARY | Q9BZE9 | VCP P55072 | 34 | EBI-1993677, EBI-355164 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 182-324 | Disordered | ||||
Sequence: PGSLGSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSSAKLPKSLSSPGGPSKPKKSKSGQDPQQEQEQERERDPQQEQERERPVDREPVDREPVV | ||||||
Compositional bias | 209-224 | Basic and acidic residues | ||||
Sequence: RGDLSRPEDADTSGPC | ||||||
Compositional bias | 259-286 | Polar residues | ||||
Sequence: TRPLTSSSAKLPKSLSSPGGPSKPKKSK | ||||||
Compositional bias | 287-324 | Basic and acidic residues | ||||
Sequence: SGQDPQQEQEQERERDPQQEQERERPVDREPVDREPVV | ||||||
Region | 317-380 | Interaction with GLUT4 | ||||
Sequence: PVDREPVVCHPDLEERLQAWPAELPDEFFELTVDDVRRRLAQLKSERKRLEEAPLVTKAFREAQ | ||||||
Domain | 386-462 | UBX | ||||
Sequence: ERYPKVALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLGNPELSFYLFITPPKTVLDDHTQTLFQANLFPAALVHL | ||||||
Region | 499-536 | Disordered | ||||
Sequence: GSPSPLPAPDPAPKSEPAAEEGALVPPEPIPGTAQPVK |
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
Q9BZE9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length553
- Mass (Da)60,183
- Last updated2001-06-01 v1
- ChecksumB013FDF9A48D2E5E
Q9BZE9-2
- Name2
- Differences from canonical
- 451-451: Q → QPQLGDRVAPFTLGPSLKRCLGPEQRTRLPVVGDGGDVDSGRLLFWGPSRGRASPSTGQPPCHPVCRPSSPPSPRPSSGDPSRVKAGHKHVGTGR
Q9BZE9-3
- Name3
Q9BZE9-4
- Name4
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_020574 | 1-77 | in isoform 3 and isoform 4 | |||
Sequence: Missing | ||||||
Compositional bias | 209-224 | Basic and acidic residues | ||||
Sequence: RGDLSRPEDADTSGPC | ||||||
Sequence conflict | 257 | in Ref. 2; BAB71595 | ||||
Sequence: G → E | ||||||
Compositional bias | 259-286 | Polar residues | ||||
Sequence: TRPLTSSSAKLPKSLSSPGGPSKPKKSK | ||||||
Compositional bias | 287-324 | Basic and acidic residues | ||||
Sequence: SGQDPQQEQEQERERDPQQEQERERPVDREPVDREPVV | ||||||
Alternative sequence | VSP_020575 | 390-425 | in isoform 4 | |||
Sequence: KVALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLG → RRSLSLSPRLESVVPSQLTASSASRVQVVLLPQPPK | ||||||
Alternative sequence | VSP_020576 | 426-553 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_020577 | 434 | in isoform 3 | |||
Sequence: F → CLSSFGRMDGRGPRCFLTRRCLLSSV | ||||||
Sequence conflict | 444 | in Ref. 2; BAB71595 | ||||
Sequence: D → G | ||||||
Alternative sequence | VSP_020578 | 451 | in isoform 2 | |||
Sequence: Q → QPQLGDRVAPFTLGPSLKRCLGPEQRTRLPVVGDGGDVDSGRLLFWGPSRGRASPSTGQPPCHPVCRPSSPPSPRPSSGDPSRVKAGHKHVGTGR |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF324219 EMBL· GenBank· DDBJ | AAK08959.2 EMBL· GenBank· DDBJ | mRNA | ||
AK057403 EMBL· GenBank· DDBJ | BAB71472.1 EMBL· GenBank· DDBJ | mRNA | ||
AK057851 EMBL· GenBank· DDBJ | BAB71595.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290624 EMBL· GenBank· DDBJ | BAF83313.1 EMBL· GenBank· DDBJ | mRNA | ||
BC006152 EMBL· GenBank· DDBJ | AAH06152.1 EMBL· GenBank· DDBJ | mRNA | ||
BC018722 EMBL· GenBank· DDBJ | AAH18722.1 EMBL· GenBank· DDBJ | mRNA |