Q9BYQ5 · KRA46_HUMAN
- ProteinKeratin-associated protein 4-6
- GeneKRTAP4-6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids205 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | keratin filament |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKeratin-associated protein 4-6
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BYQ5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 346 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000185181 | 1-205 | Keratin-associated protein 4-6 | |||
Sequence: MVSSCCGSVCSDQGCGLETCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCSISSCCRPSCCVSRCCRSQCCQSVCCQPTCCRPSCCISSCCRPSCCESSCCRPCCCRPCCCLRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC |
Proteomic databases
PTM databases
Interaction
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 20-24 | 1 | ||||
Sequence: CCRPS | ||||||
Region | 20-173 | 30 X 5 AA repeats of C-C-[IRQVEL]-[SPTR]-[STVQRCP] | ||||
Sequence: CCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCSISSCCRPSCCVSRCCRSQCCQSVCCQPTCCRPSCCISSCCRPSCCESSCCRPCCCRPCCCLRP | ||||||
Repeat | 25-29 | 2 | ||||
Sequence: CCQTT | ||||||
Repeat | 30-34 | 3 | ||||
Sequence: CCRTT | ||||||
Repeat | 35-39 | 4 | ||||
Sequence: CCRPS | ||||||
Repeat | 40-44 | 5 | ||||
Sequence: CCVSS | ||||||
Repeat | 45-49 | 6 | ||||
Sequence: CCRPQ | ||||||
Repeat | 50-54 | 7 | ||||
Sequence: CCQSV | ||||||
Repeat | 55-59 | 8 | ||||
Sequence: CCQPT | ||||||
Repeat | 60-64 | 9 | ||||
Sequence: CCRPS | ||||||
Repeat | 65-68 | 10 | ||||
Sequence: CCPS | ||||||
Repeat | 69-73 | 11 | ||||
Sequence: CCQTT | ||||||
Repeat | 74-78 | 12 | ||||
Sequence: CCRTT | ||||||
Repeat | 79-83 | 13 | ||||
Sequence: CCRPS | ||||||
Repeat | 84-88 | 14 | ||||
Sequence: CCVSS | ||||||
Repeat | 89-93 | 15 | ||||
Sequence: CCRPQ | ||||||
Repeat | 94-98 | 16 | ||||
Sequence: CCQSV | ||||||
Repeat | 99-103 | 17 | ||||
Sequence: CCQPT | ||||||
Repeat | 104-108 | 18 | ||||
Sequence: CCRPS | ||||||
Repeat | 114-118 | 19 | ||||
Sequence: CCRPS | ||||||
Repeat | 119-123 | 20 | ||||
Sequence: CCVSR | ||||||
Repeat | 124-128 | 21 | ||||
Sequence: CCRSQ | ||||||
Repeat | 129-133 | 22 | ||||
Sequence: CCQSV | ||||||
Repeat | 134-138 | 23 | ||||
Sequence: CCQPT | ||||||
Repeat | 139-143 | 24 | ||||
Sequence: CCRPS | ||||||
Repeat | 144-148 | 25 | ||||
Sequence: CCISS | ||||||
Repeat | 149-153 | 26 | ||||
Sequence: CCRPS | ||||||
Repeat | 154-158 | 27 | ||||
Sequence: CCESS | ||||||
Repeat | 159-163 | 28 | ||||
Sequence: CCRPC | ||||||
Repeat | 164-168 | 29 | ||||
Sequence: CCRPC | ||||||
Repeat | 169-173 | 30 | ||||
Sequence: CCLRP |
Sequence similarities
Belongs to the KRTAP type 4 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length205
- Mass (Da)21,825
- Last updated2014-05-14 v4
- ChecksumFCB85AF744EA436A
Sequence caution
Polymorphism
Numerous size polymorphism are present in KRTAP4 gene family, which are mainly due to variations in the sequence encoding cysteine-rich repeat segments (PubMed:15955084).
Allele shown is KAP4.15 (PubMed:15955084).
Allele shown is KAP4.15 (PubMed:15955084).
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC100808 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AJ406945 EMBL· GenBank· DDBJ | CAC27584.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ406938 EMBL· GenBank· DDBJ | CAC27577.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |