Q9BXJ4 · C1QT3_HUMAN
- ProteinComplement C1q tumor necrosis factor-related protein 3
- GeneC1QTNF3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids246 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | collagen trimer | |
Cellular Component | extracellular exosome | |
Cellular Component | extracellular space | |
Cellular Component | membrane | |
Molecular Function | identical protein binding | |
Biological Process | fat cell differentiation | |
Biological Process | intracellular triglyceride homeostasis | |
Biological Process | negative regulation of gene expression | |
Biological Process | negative regulation of gluconeogenesis | |
Biological Process | negative regulation of inflammatory response | |
Biological Process | negative regulation of interleukin-6 production | |
Biological Process | negative regulation of monocyte chemotactic protein-1 production | |
Biological Process | negative regulation of non-canonical NF-kappaB signal transduction | |
Biological Process | positive regulation of adiponectin secretion | |
Biological Process | positive regulation of cytokine production |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameComplement C1q tumor necrosis factor-related protein 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BXJ4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 282 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MLWRQLIYWQLLALFFLPFCLC | ||||||
Chain | PRO_0000003531 | 23-246 | Complement C1q tumor necrosis factor-related protein 3 | |||
Sequence: QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK | ||||||
Glycosylation | 70 | In isoform Q9BXJ4-3; N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Isoform 3
Glycosylated on Asn-70.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BXJ4 | COLGALT2 Q8IYK4 | 2 | EBI-10697546, EBI-10263496 | |
BINARY | Q9BXJ4 | HTT P42858 | 3 | EBI-10697546, EBI-466029 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 51-113 | Collagen-like | ||||
Sequence: GYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIP | ||||||
Region | 53-110 | Disordered | ||||
Sequence: QGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYP | ||||||
Compositional bias | 81-104 | Basic and acidic residues | ||||
Sequence: GAKGEKGDKGDLGPRGERGQHGPK | ||||||
Domain | 113-246 | C1q | ||||
Sequence: PPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
Q9BXJ4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length246
- Mass (Da)26,994
- Last updated2001-06-01 v1
- ChecksumC589B6C3A73E5D29
Q9BXJ4-2
- Name2
Q9BXJ4-3
- Name3
- Differences from canonical
- 28-28: E → EVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDNNTSTDLKSLRPDELPHPEVDDLAQITTFWGQ
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_043157 | 28 | in isoform 3 | |||
Sequence: E → EVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDNNTSTDLKSLRPDELPHPEVDDLAQITTFWGQ | ||||||
Alternative sequence | VSP_011624 | 46-69 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 81-104 | Basic and acidic residues | ||||
Sequence: GAKGEKGDKGDLGPRGERGQHGPK | ||||||
Alternative sequence | VSP_011625 | 82-105 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF329837 EMBL· GenBank· DDBJ | AAK17961.1 EMBL· GenBank· DDBJ | mRNA | ||
AF326976 EMBL· GenBank· DDBJ | AAK70344.1 EMBL· GenBank· DDBJ | mRNA | ||
EU399231 EMBL· GenBank· DDBJ | ABY86416.1 EMBL· GenBank· DDBJ | mRNA | ||
EU399232 EMBL· GenBank· DDBJ | ABY86417.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358388 EMBL· GenBank· DDBJ | AAQ88754.1 EMBL· GenBank· DDBJ | mRNA | ||
AK295968 EMBL· GenBank· DDBJ | BAG58744.1 EMBL· GenBank· DDBJ | mRNA | ||
AK315921 EMBL· GenBank· DDBJ | BAH14292.1 EMBL· GenBank· DDBJ | mRNA | ||
AK075533 EMBL· GenBank· DDBJ | BAC11676.1 EMBL· GenBank· DDBJ | mRNA | ||
BX640995 EMBL· GenBank· DDBJ | CAE45998.1 EMBL· GenBank· DDBJ | mRNA | ||
AC139783 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC139792 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471118 EMBL· GenBank· DDBJ | EAX10820.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC112925 EMBL· GenBank· DDBJ | AAI12926.1 EMBL· GenBank· DDBJ | mRNA | ||
BC120990 EMBL· GenBank· DDBJ | AAI20991.1 EMBL· GenBank· DDBJ | mRNA | ||
AF173888 EMBL· GenBank· DDBJ | AAQ13635.1 EMBL· GenBank· DDBJ | mRNA |