Q9BXJ0 · C1QT5_HUMAN
- ProteinComplement C1q tumor necrosis factor-related protein 5
- GeneC1QTNF5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids243 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
Miscellaneous
This protein is produced by a bicistronic gene which also produces the MFRP protein from a non-overlapping reading frame.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | bicellular tight junction | |
Cellular Component | cell projection | |
Cellular Component | collagen trimer | |
Cellular Component | extracellular space | |
Cellular Component | lateral plasma membrane | |
Cellular Component | plasma membrane | |
Cellular Component | transport vesicle | |
Molecular Function | identical protein binding | |
Biological Process | inner ear development | |
Biological Process | protein secretion |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameComplement C1q tumor necrosis factor-related protein 5
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BXJ0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Late-onset retinal degeneration (LORD)
- Note
- DescriptionAutosomal dominant disorder characterized by onset in the fifth to sixth decade with night blindness and punctate yellow-white deposits in the retinal fundus, progressing to severe central and peripheral degeneration, with choroidal neovascularization and chorioretinal atrophy.
- See alsoMIM:605670
Natural variants in LORD
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_032629 | 163 | S>R | in LORD; dbSNP:rs111033578 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_032628 | 44 | in dbSNP:rs11538245 | |||
Sequence: Q → R | ||||||
Natural variant | VAR_032629 | 163 | in LORD; dbSNP:rs111033578 | |||
Sequence: S → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 299 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-15 | |||||
Sequence: MRPLLVLLLLGLAAG | ||||||
Chain | PRO_0000003535 | 16-243 | Complement C1q tumor necrosis factor-related protein 5 | |||
Sequence: SPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
May interact with ERFE (By similarity).
Homotrimer (via collagen-like domain). May form higher order oligomers by supercoiling of the trimers
Homotrimer (via collagen-like domain). May form higher order oligomers by supercoiling of the trimers
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BXJ0 | C1QTNF5 Q9BXJ0 | 3 | EBI-19947914, EBI-19947914 | |
BINARY | Q9BXJ0 | GUCA1A P43080 | 3 | EBI-19947914, EBI-6873005 | |
BINARY | Q9BXJ0 | MFRP Q9BY79 | 3 | EBI-19947914, EBI-29375513 | |
BINARY | Q9BXJ0 | SGTA O43765 | 3 | EBI-19947914, EBI-347996 | |
BINARY | Q9BXJ0 | SGTB Q96EQ0 | 3 | EBI-19947914, EBI-744081 | |
BINARY | PRO_0000003535 | C1QTNF5 PRO_0000003535 Q9BXJ0 | 2 | EBI-34575799, EBI-34575799 | |
BINARY | PRO_0000003535 | MFRP Q9BY79 | 5 | EBI-34575799, EBI-29375513 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 15-125 | Disordered | ||||
Sequence: GSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPGLPGPRGDPGPRGEAGPAGPTGPAGECSVPPRSAFSAKRSESRVPPPSDAPLPF | ||||||
Domain | 30-95 | Collagen-like | ||||
Sequence: GHPGLPGTPGHHGSQGLPGRDGRDGRDGAPGAPGEKGEGGRPGLPGPRGDPGPRGEAGPAGPTGPA | ||||||
Compositional bias | 46-60 | Basic and acidic residues | ||||
Sequence: LPGRDGRDGRDGAPG | ||||||
Domain | 99-238 | C1q | ||||
Sequence: SVPPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length243
- Mass (Da)25,298
- Last updated2001-06-01 v1
- Checksum7CCDA65CDA7EB784
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0U1RQW5 | A0A0U1RQW5_HUMAN | C1QTNF5 | 60 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 46-60 | Basic and acidic residues | ||||
Sequence: LPGRDGRDGRDGAPG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF329841 EMBL· GenBank· DDBJ | AAK17965.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ862823 EMBL· GenBank· DDBJ | CAH93522.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358383 EMBL· GenBank· DDBJ | AAQ88749.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471065 EMBL· GenBank· DDBJ | EAW67481.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
EF444994 EMBL· GenBank· DDBJ | ACA06014.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC029485 EMBL· GenBank· DDBJ | AAH29485.1 EMBL· GenBank· DDBJ | mRNA | ||
AL110261 EMBL· GenBank· DDBJ | CAB53702.1 EMBL· GenBank· DDBJ | mRNA |