Q9BX46 · RBM24_HUMAN
- ProteinRNA-binding protein 24
- GeneRBM24
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids236 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Multifunctional RNA-binding protein involved in the regulation of pre-mRNA splicing, mRNA stability and mRNA translation important for cell fate decision and differentiation (PubMed:20977548, PubMed:24375645, PubMed:29104163, PubMed:29358667).
Plays a major role in pre-mRNA alternative splicing regulation (PubMed:26990106, PubMed:29104163).
Mediates preferentially muscle-specific exon inclusion in numerous mRNAs important for striated cardiac and skeletal muscle cell differentiation (PubMed:29104163).
Binds to intronic splicing enhancer (ISE) composed of stretches of GU-rich motifs localized in flanking intron of exon that will be included by alternative splicing (By similarity).
Involved in embryonic stem cell (ESC) transition to cardiac cell differentiation by promoting pre-mRNA alternative splicing events of several pluripotency and/or differentiation genes (PubMed:26990106).
Plays a role in the regulation of mRNA stability (PubMed:20977548, PubMed:24356969, PubMed:24375645, PubMed:29104163).
Binds to 3'-untranslated region (UTR) AU-rich elements in target transcripts, such as CDKN1A and MYOG, leading to maintain their stabilities (PubMed:20977548, PubMed:24356969).
Involved in myogenic differentiation by regulating MYOG levels (PubMed:20977548).
Binds to multiple regions in the mRNA 3'-UTR of TP63 isoform 2, hence inducing its destabilization (PubMed:24375645).
Promotes also the destabilization of the CHRM2 mRNA via its binding to a region in the coding sequence (PubMed:29104163).
Plays a role in the regulation of mRNA translation (PubMed:29358667).
Mediates repression of p53/TP53 mRNA translation through its binding to U-rich element in the 3'-UTR, hence preventing EIF4E from binding to p53/TP53 mRNA and translation initiation (PubMed:29358667).
Binds to a huge amount of mRNAs (PubMed:29104163).
Required for embryonic heart development, sarcomer and M-band formation in striated muscles (By similarity).
Together with RBM20, promotes the expression of short isoforms of PDLIM5/ENH in cardiomyocytes (By similarity).
Plays a major role in pre-mRNA alternative splicing regulation (PubMed:26990106, PubMed:29104163).
Mediates preferentially muscle-specific exon inclusion in numerous mRNAs important for striated cardiac and skeletal muscle cell differentiation (PubMed:29104163).
Binds to intronic splicing enhancer (ISE) composed of stretches of GU-rich motifs localized in flanking intron of exon that will be included by alternative splicing (By similarity).
Involved in embryonic stem cell (ESC) transition to cardiac cell differentiation by promoting pre-mRNA alternative splicing events of several pluripotency and/or differentiation genes (PubMed:26990106).
Plays a role in the regulation of mRNA stability (PubMed:20977548, PubMed:24356969, PubMed:24375645, PubMed:29104163).
Binds to 3'-untranslated region (UTR) AU-rich elements in target transcripts, such as CDKN1A and MYOG, leading to maintain their stabilities (PubMed:20977548, PubMed:24356969).
Involved in myogenic differentiation by regulating MYOG levels (PubMed:20977548).
Binds to multiple regions in the mRNA 3'-UTR of TP63 isoform 2, hence inducing its destabilization (PubMed:24375645).
Promotes also the destabilization of the CHRM2 mRNA via its binding to a region in the coding sequence (PubMed:29104163).
Plays a role in the regulation of mRNA translation (PubMed:29358667).
Mediates repression of p53/TP53 mRNA translation through its binding to U-rich element in the 3'-UTR, hence preventing EIF4E from binding to p53/TP53 mRNA and translation initiation (PubMed:29358667).
Binds to a huge amount of mRNAs (PubMed:29104163).
Required for embryonic heart development, sarcomer and M-band formation in striated muscles (By similarity).
Together with RBM20, promotes the expression of short isoforms of PDLIM5/ENH in cardiomyocytes (By similarity).
(Microbial infection) Promotes hepatitis C virus (HCV) replication over translation through the inhibition of viral protein expression. Decreases viral translation by linking viral 5'- and 3'-UTRs, blocking 80S ribosome assembly on the viral IRES and enhancing the interaction of the mature core protein and 5'-UTR.
GO annotations
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRNA-binding protein 24
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BX46
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 181 | Decreases p53/TP53 expression. | ||||
Sequence: S → A | ||||||
Mutagenesis | 181 | Increases p53/TP53 expression. | ||||
Sequence: S → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 247 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000273370 | 1-236 | RNA-binding protein 24 | |||
Sequence: MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTAAAASTTPYIDYTGAAYAQYSAAAAAAAAAAAYDQYPYAASPAAAGYVTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQYQPQQLQTDRMQ |
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with EIF4E; this interaction prevents EIF4E from binding to p53/TP53 mRNA and inhibits the assembly of translation initiation complex (PubMed:29358667).
(Microbial infection) Interacts with HCV mature core protein; this interaction, which enhances the interaction of Core with 5'-UTR may favor viral replication over translation.
(Microbial infection) Interacts with HCV Serine protease/helicase NS3.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BX46-2 | C10orf55 Q5SWW7 | 3 | EBI-12224445, EBI-12809220 | |
BINARY | Q9BX46-2 | DAZAP2 Q15038 | 3 | EBI-12224445, EBI-724310 | |
BINARY | Q9BX46-2 | POU2AF1 Q16633 | 3 | EBI-12224445, EBI-943588 | |
BINARY | Q9BX46-2 | RBPMS Q93062-3 | 3 | EBI-12224445, EBI-740343 | |
BINARY | Q9BX46-2 | UBQLN2 Q9UHD9 | 3 | EBI-12224445, EBI-947187 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-88 | RRM | ||||
Sequence: TKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYL | ||||||
Region | 175-199 | Necessary for interaction with EIF4E | ||||
Sequence: QYPYAASPAAAGYVTAGGYGYAVQQ |
Domain
The RRM domain is necessary for mRNA stability and mRNA translation regulation (PubMed:24356969, PubMed:29358667).
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q9BX46-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length236
- Mass (Da)24,776
- Last updated2001-06-01 v1
- Checksum1CFB5AEBD4E3AA24
Q9BX46-2
- Name2
- Differences from canonical
- 1-56: MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGF → MYVCLCVSVAK
Q9BX46-5
- Name3
- Differences from canonical
- 1-58: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK055391 EMBL· GenBank· DDBJ | BAB70914.1 EMBL· GenBank· DDBJ | mRNA | ||
AK095016 EMBL· GenBank· DDBJ | BAC04474.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AY547318 EMBL· GenBank· DDBJ | AAS55633.1 EMBL· GenBank· DDBJ | mRNA | ||
AL136305 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC104810 EMBL· GenBank· DDBJ | AAI04811.1 EMBL· GenBank· DDBJ | mRNA | ||
BC104808 EMBL· GenBank· DDBJ | AAI04809.1 EMBL· GenBank· DDBJ | mRNA |