Q9BX26 · SYCP2_HUMAN
- ProteinSynaptonemal complex protein 2
- GeneSYCP2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1530 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Major component of the axial/lateral elements of synaptonemal complexes (SCS) during meiotic prophase. Plays a role in the assembly of synaptonemal complexes. Required for normal meiotic chromosome synapsis during oocyte and spermatocyte development and for normal male and female fertility. Required for insertion of SYCP3 into synaptonemal complexes. May be involved in the organization of chromatin by temporarily binding to DNA scaffold attachment regions. Requires SYCP3, but not SYCP1, in order to be incorporated into the axial/lateral elements.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | condensed chromosome, centromeric region | |
Cellular Component | lateral element | |
Cellular Component | nucleus | |
Cellular Component | synaptonemal complex | |
Molecular Function | DNA binding | |
Biological Process | apoptotic process | |
Biological Process | cell division | |
Biological Process | ectopic germ cell programmed cell death | |
Biological Process | female meiotic nuclear division | |
Biological Process | fertilization | |
Biological Process | male genitalia morphogenesis | |
Biological Process | male meiotic nuclear division | |
Biological Process | negative regulation of apoptotic process | |
Biological Process | negative regulation of developmental process | |
Biological Process | negative regulation of reproductive process | |
Biological Process | synaptonemal complex assembly |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSynaptonemal complex protein 2
- Short namesSCP-2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BX26
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: In axial/lateral elements of the tripartite segments of synaptonemal complexes.
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Spermatogenic failure 1 (SPGF1)
- Note
- DescriptionAn infertility disorder characterized by azoospermia due to spermatogenic arrest during meiosis. Meiotic arrest is characterized by germ cells that enter meiosis and undergo the first chromosomal reduction from 4n to 2n, but that are then unable to proceed further. This results in tubules containing spermatocytes as the latest developmental stage of germ cells. Meiotically arrested spermatocytes accumulate in the tubules and degenerate. Both autosomal recessive and autosomal dominant inheritance have been reported.
- See alsoMIM:258150
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_054059 | 353 | in dbSNP:rs13039338 | |||
Sequence: T → K | ||||||
Natural variant | VAR_014115 | 523 | in dbSNP:rs1359836 | |||
Sequence: P → L | ||||||
Natural variant | VAR_054060 | 751 | in dbSNP:rs6071006 | |||
Sequence: T → I | ||||||
Natural variant | VAR_054061 | 1155 | in dbSNP:rs6128714 | |||
Sequence: V → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,960 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000072366 | 1-1530 | Synaptonemal complex protein 2 | |||
Sequence: MPIRPDLQQLEKCIDDALRKNDFKPLKTLLQIDICEDVKIKCSKQFFHKVDNLICRELNKEDIHNVSAILVSVGRCGKNISVLGQAGLLTMIKQGLIQKMVAWFEKSKDIIQSQGNSKDEAVLNMIEDLVDLLLVIHDVSDEGKKQVVESFVPRICSLVIDSRVNICIQQEIIKKMNAMLDKMPQDARKILSNQEMLILMSSMGERILDAGDYDLQVGIVEALCRMTTEKQRQELAHQWFSMDFIAKAFKRIKDSEFETDCRIFLNLVNGMLGDKRRVFTFPCLSAFLDKYELQIPSDEKLEEFWIDFNLGSQTLSFYIAGDNDDHQWEAVTVPEEKVQIYSIEVRESKKLLTIILKNTVKISKREGKELLLYFDASLEITNVTQKIFGATKHRESIRKQGISVAKTSLHILFDASGSQILVPESQISPVGEELVSLKEKSKSPKEFAKPSKYIKNSDKGNRNNSQLEKTTPSKRKMSEASMIVSGADRYTMRSPVLFSNTSIPPRRRRIKPPLQMTSSAEKPSVSQTSENRVDNAASLKSRSSEGRHRRDNIDKHIKTAKCVENTENKNVEFPNQNFSELQDVIPDSQAAEKRDHTILPGVLDNICGNKIHSKWACWTPVTNIELCNNQRASTSSGDTLNQDIVINKKLTKQKSSSSISDHNSEGTGKVKYKKEQTDHIKIDKAEVEVCKKHNQQQNHPKYSGQKNTENAKQSDWPVESETTFKSVLLNKTIEESLIYRKKYILSKDVNTATCDKNPSASKNVQSHRKAEKELTSELNSWDSKQKKMREKSKGKEFTNVAESLISQINKRYKTKDDIKSTRKLKESLINSGFSNKPVVQLSKEKVQKKSYRKLKTTFVNVTSECPVNDVYNFNLNGADDPIIKLGIQEFQATAKEACADRSIRLVGPRNHDELKSSVKTKDKKIITNHQKKNLFSDTETEYRCDDSKTDISWLREPKSKPQLIDYSRNKNVKNHKSGKSRSSLEKGQPSSKMTPSKNITKKMDKTIPEGRIRLPRKATKTKKNYKDLSNSESECEQEFSHSFKENIPVKEENIHSRMKTVKLPKKQQKVFCAETEKELSKQWKNSSLLKDAIRDNCLDLSPRSLSGSPSSIEVTRCIEKITEKDFTQDYDCITKSISPYPKTSSLESLNSNSGVGGTIKSPKNNEKNFLCASESCSPIPRPLFLPRHTPTKSNTIVNRKKISSLVLTQETQNSNSYSDVSSYSSEERFMEIESPHINENYIQSKREESHLASSLSKSSEGREKTWFDMPCDATHVSGPTQHLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRIKKLDKFQFIIIEELENFEKDSQSLKDLEKEFVDFWEKIFQKFSAYQKSEQQRLHLLKTSLAKSVFCNTDSEETVFTSEMCLMKEDMKVLQDRLLKDMLEEELLNVRRELMSVFMSHERNANV | ||||||
Modified residue | 457 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 465 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 471 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 494 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 519 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 529 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 538 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 619 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 660 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 664 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 936 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 938 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 1136 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1138 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1145 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1161 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1177 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1189 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 1204 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1234 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1253 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1295 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1297 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1339 | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
Phosphorylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of the lateral elements of synaptonemal complexes. Heterodimer with SYCP3 (By similarity).
Interacts with SMC1A and SMC3 (By similarity).
Interacts with TEX11 (By similarity).
Interacts with SMC1A and SMC3 (By similarity).
Interacts with TEX11 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 439-456 | Basic and acidic residues | ||||
Sequence: EKSKSPKEFAKPSKYIKN | ||||||
Region | 439-480 | Disordered | ||||
Sequence: EKSKSPKEFAKPSKYIKNSDKGNRNNSQLEKTTPSKRKMSEA | ||||||
Compositional bias | 457-471 | Polar residues | ||||
Sequence: SDKGNRNNSQLEKTT | ||||||
Region | 496-555 | Disordered | ||||
Sequence: VLFSNTSIPPRRRRIKPPLQMTSSAEKPSVSQTSENRVDNAASLKSRSSEGRHRRDNIDK | ||||||
Compositional bias | 517-540 | Polar residues | ||||
Sequence: TSSAEKPSVSQTSENRVDNAASLK | ||||||
Compositional bias | 541-555 | Basic and acidic residues | ||||
Sequence: SRSSEGRHRRDNIDK | ||||||
Region | 653-676 | Disordered | ||||
Sequence: QKSSSSISDHNSEGTGKVKYKKEQ | ||||||
Region | 693-717 | Disordered | ||||
Sequence: HNQQQNHPKYSGQKNTENAKQSDWP | ||||||
Compositional bias | 696-717 | Polar residues | ||||
Sequence: QQNHPKYSGQKNTENAKQSDWP | ||||||
Region | 755-795 | Disordered | ||||
Sequence: DKNPSASKNVQSHRKAEKELTSELNSWDSKQKKMREKSKGK | ||||||
Compositional bias | 765-795 | Basic and acidic residues | ||||
Sequence: QSHRKAEKELTSELNSWDSKQKKMREKSKGK | ||||||
Region | 962-1003 | Disordered | ||||
Sequence: QLIDYSRNKNVKNHKSGKSRSSLEKGQPSSKMTPSKNITKKM | ||||||
Compositional bias | 983-997 | Polar residues | ||||
Sequence: SLEKGQPSSKMTPSK |
Sequence similarities
Belongs to the SYCP2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,530
- Mass (Da)175,639
- Last updated2002-10-10 v2
- Checksum3676EB133C53F1FA
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 218 | in Ref. 1; CAA70171 | ||||
Sequence: G → A | ||||||
Compositional bias | 439-456 | Basic and acidic residues | ||||
Sequence: EKSKSPKEFAKPSKYIKN | ||||||
Compositional bias | 457-471 | Polar residues | ||||
Sequence: SDKGNRNNSQLEKTT | ||||||
Compositional bias | 517-540 | Polar residues | ||||
Sequence: TSSAEKPSVSQTSENRVDNAASLK | ||||||
Compositional bias | 541-555 | Basic and acidic residues | ||||
Sequence: SRSSEGRHRRDNIDK | ||||||
Sequence conflict | 691 | in Ref. 1; CAA70171 | ||||
Sequence: K → R | ||||||
Compositional bias | 696-717 | Polar residues | ||||
Sequence: QQNHPKYSGQKNTENAKQSDWP | ||||||
Compositional bias | 765-795 | Basic and acidic residues | ||||
Sequence: QSHRKAEKELTSELNSWDSKQKKMREKSKGK | ||||||
Sequence conflict | 794-797 | in Ref. 4 | ||||
Sequence: GKEF → KKKK | ||||||
Compositional bias | 983-997 | Polar residues | ||||
Sequence: SLEKGQPSSKMTPSK | ||||||
Sequence conflict | 1179 | in Ref. 1; CAA70171 | ||||
Sequence: I → T | ||||||
Sequence conflict | 1186 | in Ref. 1; CAA70171 | ||||
Sequence: P → A | ||||||
Sequence conflict | 1222 | in Ref. 1; CAA70171 | ||||
Sequence: S → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y08982 EMBL· GenBank· DDBJ | CAA70171.1 EMBL· GenBank· DDBJ | mRNA | ||
AL109928 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL158092 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC132864 EMBL· GenBank· DDBJ | AAI32865.1 EMBL· GenBank· DDBJ | mRNA | ||
BC132870 EMBL· GenBank· DDBJ | AAI32871.1 EMBL· GenBank· DDBJ | mRNA | ||
AL080226 EMBL· GenBank· DDBJ | CAB45780.1 EMBL· GenBank· DDBJ | mRNA |