Q9BV47 · DUS26_HUMAN
- ProteinDual specificity protein phosphatase 26
- GeneDUSP26
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids211 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Catalytic activity
- H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 152 | Phosphocysteine intermediate | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular exosome | |
Cellular Component | Golgi apparatus | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | MAP kinase phosphatase activity | |
Molecular Function | myosin phosphatase activity | |
Molecular Function | p53 binding | |
Molecular Function | phosphoprotein phosphatase activity | |
Molecular Function | protein tyrosine phosphatase activity | |
Molecular Function | protein tyrosine/serine/threonine phosphatase activity | |
Molecular Function | RNA polymerase II-specific DNA-binding transcription factor binding | |
Biological Process | negative regulation of ERK1 and ERK2 cascade | |
Biological Process | negative regulation of MAPK cascade | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of cell adhesion | |
Biological Process | protein dephosphorylation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDual specificity protein phosphatase 26
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BV47
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 152 | Loss of activity. | ||||
Sequence: C → A or S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 275 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000292219 | 1-211 | Dual specificity protein phosphatase 26 | |||
Sequence: MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA |
Proteomic databases
PTM databases
Expression
Tissue specificity
Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with HSF4.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BV47 | CALCOCO2 Q13137 | 3 | EBI-2924519, EBI-739580 | |
BINARY | Q9BV47 | CARD10 Q9BWT7 | 3 | EBI-2924519, EBI-3866279 | |
BINARY | Q9BV47 | GOLGA6L9 A6NEM1 | 3 | EBI-2924519, EBI-5916454 | |
BINARY | Q9BV47 | GRIPAP1 Q4V328 | 3 | EBI-2924519, EBI-717919 | |
BINARY | Q9BV47 | KRT27 Q7Z3Y8 | 3 | EBI-2924519, EBI-3044087 | |
BINARY | Q9BV47 | TP53 P04637 | 9 | EBI-2924519, EBI-366083 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 60-207 | Tyrosine-protein phosphatase | ||||
Sequence: NHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQ |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9BV47-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length211
- Mass (Da)23,946
- Last updated2001-06-01 v1
- Checksum60E944304905086D
Q9BV47-2
- Name2
- Differences from canonical
- 1-125: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E5RHD0 | E5RHD0_HUMAN | DUSP26 | 145 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_026406 | 1-125 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY902194 EMBL· GenBank· DDBJ | AAX07132.1 EMBL· GenBank· DDBJ | mRNA | ||
AB158288 EMBL· GenBank· DDBJ | BAD82942.1 EMBL· GenBank· DDBJ | mRNA | ||
AB237597 EMBL· GenBank· DDBJ | BAE46506.1 EMBL· GenBank· DDBJ | mRNA | ||
AB103376 EMBL· GenBank· DDBJ | BAD91015.1 EMBL· GenBank· DDBJ | mRNA | ||
AK055704 EMBL· GenBank· DDBJ | BAB70991.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471080 EMBL· GenBank· DDBJ | EAW63392.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471080 EMBL· GenBank· DDBJ | EAW63393.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471080 EMBL· GenBank· DDBJ | EAW63394.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC001613 EMBL· GenBank· DDBJ | AAH01613.1 EMBL· GenBank· DDBJ | mRNA | ||
BC003115 EMBL· GenBank· DDBJ | AAH03115.1 EMBL· GenBank· DDBJ | mRNA | ||
BC067804 EMBL· GenBank· DDBJ | AAH67804.1 EMBL· GenBank· DDBJ | mRNA |