Q9BU20 · CPLN2_HUMAN
- ProteinCiliogenesis and planar polarity effector 2
- GeneCPLANE2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids258 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for efficient primary cilia initiation, regulating a late step in cilia initiation. Plays a role in the final maturation of the mother centriole and ciliary vesicle that allows extension of the ciliary axoneme.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 64 | GTP (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 65 | GTP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 67 | GTP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 68 | GTP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 69 | GTP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 70 | GTP (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 82 | GTP (UniProtKB | ChEBI) | ||||
Sequence: V | ||||||
Binding site | 84 | GTP (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 87 | GTP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 176 | GTP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 178 | GTP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 206 | GTP (UniProtKB | ChEBI) | ||||
Sequence: S |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | centriole | |
Cellular Component | ciliary basal body | |
Cellular Component | ciliary base | |
Cellular Component | ciliary transition zone | |
Cellular Component | cytoplasm | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | axoneme assembly | |
Biological Process | cilium assembly | |
Biological Process | cranial skeletal system development | |
Biological Process | endocardial cushion fusion | |
Biological Process | exocytosis | |
Biological Process | limb development | |
Biological Process | protein localization | |
Biological Process | protein processing | |
Biological Process | protein transport | |
Biological Process | regulation of exocytosis | |
Biological Process | regulation of smoothened signaling pathway | |
Biological Process | regulation of vesicle fusion | |
Biological Process | smoothened signaling pathway |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCiliogenesis and planar polarity effector 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BU20
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes at the transition zone, a region between the basal body and the ciliary axoneme (PubMed:29038301).
Recruitment to the centriole depends on TTBK2, INTU, and its own GTPase activity (By similarity).
Recruitment to the centriole depends on TTBK2, INTU, and its own GTPase activity (By similarity).
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_031772 | 86 | in dbSNP:rs17849687 | |||
Sequence: E → G | ||||||
Natural variant | VAR_079173 | 161 | ||||
Sequence: I → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 308 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000284538 | 1-258 | Ciliogenesis and planar polarity effector 2 | |||
Sequence: MARPPVPGSVVVPNWHESAEGKEYLACILRKNRRRVFGLLERPVLLPPVSIDTASYKIFVSGKSGVGKTALVAKLAGLEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with FUZ. Associates with the CPLANE (ciliogenesis and planar polarity effectors) complex via its interaction with FUZ (PubMed:35427153).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BU20 | FUZ Q9BT04 | 11 | EBI-750332, EBI-750341 | |
BINARY | Q9BU20 | IMPDH2 P12268 | 6 | EBI-750332, EBI-353389 | |
BINARY | Q9BU20 | RND3 P61587 | 3 | EBI-750332, EBI-1111534 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 50-258 | Small GTPase-like | ||||
Sequence: SIDTASYKIFVSGKSGVGKTALVAKLAGLEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE |
Sequence similarities
Belongs to the small GTPase superfamily. Rab family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length258
- Mass (Da)28,498
- Last updated2007-04-17 v2
- Checksum1DE50934C59A6BD0
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H0Y6L8 | H0Y6L8_HUMAN | CPLANE2 | 112 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL109627 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC002946 EMBL· GenBank· DDBJ | AAH02946.1 EMBL· GenBank· DDBJ | mRNA | ||
BC008702 EMBL· GenBank· DDBJ | AAH08702.1 EMBL· GenBank· DDBJ | mRNA |