Q9BT88 · SYT11_HUMAN
- ProteinSynaptotagmin-11
- GeneSYT11
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids431 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Synaptotagmin family member involved in vesicular and membrane trafficking which does not bind Ca2+. Inhibits clathrin-mediated and bulk endocytosis, functions to ensure precision in vesicle retrieval. Plays an important role in dopamine transmission by regulating endocytosis and the vesicle-recycling process. Essential component of a neuronal vesicular trafficking pathway that differs from the synaptic vesicle trafficking pathway but is crucial for development and synaptic plasticity. In macrophages and microglia, inhibits the conventional cytokine secretion, of at least IL6 and TNF, and phagocytosis. In astrocytes, regulates lysosome exocytosis, mechanism required for the repair of injured astrocyte cell membrane (By similarity).
Required for the ATP13A2-mediated regulation of the autophagy-lysosome pathway (PubMed:27278822).
Required for the ATP13A2-mediated regulation of the autophagy-lysosome pathway (PubMed:27278822).
Cofactor
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSynaptotagmin-11
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BT88
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle membrane ; Single-pass membrane protein
Golgi apparatus, trans-Golgi network membrane ; Single-pass membrane protein
Recycling endosome membrane ; Single-pass membrane protein
Lysosome membrane ; Single-pass membrane protein
Recycling endosome membrane ; Single-pass membrane protein
Cytoplasmic vesicle, clathrin-coated vesicle membrane ; Single-pass membrane protein
Note: Localized in vesicles that travels in axonal and dendritic shafts in both anterograde and retrograde directions. In macrophages and microglia, recruited in phagosomes at early stages of phagocytosis (By similarity).
Found in the core of the Lewy bodies in the brain of sporadic Parkinson disease patients (PubMed:12925569).
Found in the core of the Lewy bodies in the brain of sporadic Parkinson disease patients (PubMed:12925569).
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-15 | Vesicular | ||||
Sequence: MAEITNIRPSFDVSP | ||||||
Transmembrane | 16-36 | Helical | ||||
Sequence: VVAGLIGASVLVVCVSVTVFV | ||||||
Topological domain | 37-431 | Cytoplasmic | ||||
Sequence: WSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRKPVAKWHSLSEY |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_047656 | 48 | in dbSNP:rs822522 | |||
Sequence: Q → H | ||||||
Natural variant | VAR_047657 | 231 | in dbSNP:rs17853892 | |||
Sequence: G → V |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 392 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000183969 | 1-431 | UniProt | Synaptotagmin-11 | |||
Sequence: MAEITNIRPSFDVSPVVAGLIGASVLVVCVSVTVFVWSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRKPVAKWHSLSEY | |||||||
Modified residue (large scale data) | 70 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 134 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 134 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 144 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Ubiquitinated, at least by PRKN, and targeted to the proteasome complex for degradation (PubMed:12925569, PubMed:27278822).
Ubiquitination is inhibited by ATP13A2 (PubMed:27278822).
Ubiquitination is inhibited by ATP13A2 (PubMed:27278822).
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Homodimer. Can also form heterodimers. Interacts with PRKN (PubMed:12925569).
Interacts (via C2 2 domain) with AGO2 and SND1; the interaction with SND1 is direct. Interacts with KIF1A; the interaction increases in presence of calcium (By similarity).
Interacts (via C2 2 domain) with AGO2 and SND1; the interaction with SND1 is direct. Interacts with KIF1A; the interaction increases in presence of calcium (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BT88 | APPBP2 Q92624 | 3 | EBI-751770, EBI-743771 | |
BINARY | Q9BT88 | ATP13A2 Q9NQ11 | 2 | EBI-751770, EBI-6308763 | |
BINARY | Q9BT88 | PRKN O60260-5 | 6 | EBI-751770, EBI-21251460 | |
BINARY | Q9BT88 | SGTA O43765 | 7 | EBI-751770, EBI-347996 | |
BINARY | Q9BT88 | SGTB Q96EQ0 | 3 | EBI-751770, EBI-744081 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 134-154 | Disordered | ||||
Sequence: SPITSLTPGESKTTSPSSPEE | ||||||
Compositional bias | 137-154 | Polar residues | ||||
Sequence: TSLTPGESKTTSPSSPEE | ||||||
Domain | 157-279 | C2 1 | ||||
Sequence: MLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTR | ||||||
Domain | 291-426 | C2 2 | ||||
Sequence: SRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRKPVAKWH |
Domain
The second C2 domain/C2B is required for the inhibitory role in both clathrin-mediated and bulk endocytosis. The transmembrane domain and the first C2 domain/C2A are critical for the inhibitory role in clathrin-mediated endocytosis or bulk endocytosis, respectively.
Unlike in other synaptotagmin family members, the first C2 domain/C2A does not bind Ca2+ neither mediates Ca2+-dependent phospholipid binding. An aspartate-to-serine substitution in this domain inactivates Ca2+/phospho-lipid binding.
Sequence similarities
Belongs to the synaptotagmin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length431
- Mass (Da)48,297
- Last updated2008-11-25 v2
- Checksum5C8667D2C23D758E
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 50 | in Ref. 3; BAB55186 | ||||
Sequence: N → S | ||||||
Compositional bias | 137-154 | Polar residues | ||||
Sequence: TSLTPGESKTTSPSSPEE | ||||||
Sequence conflict | 268 | in Ref. 3; BAB55186 | ||||
Sequence: V → A | ||||||
Sequence conflict | 359 | in Ref. 4; CAH18653 | ||||
Sequence: F → L | ||||||
Sequence conflict | 370 | in Ref. 4; CAH18653 | ||||
Sequence: D → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D38522 EMBL· GenBank· DDBJ | BAA07527.2 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK027540 EMBL· GenBank· DDBJ | BAB55186.1 EMBL· GenBank· DDBJ | mRNA | ||
AK074931 EMBL· GenBank· DDBJ | BAC11300.1 EMBL· GenBank· DDBJ | mRNA | ||
CR749792 EMBL· GenBank· DDBJ | CAH18653.1 EMBL· GenBank· DDBJ | mRNA | ||
AL139128 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC004291 EMBL· GenBank· DDBJ | AAH04291.1 EMBL· GenBank· DDBJ | mRNA | ||
BC013690 EMBL· GenBank· DDBJ | AAH13690.1 EMBL· GenBank· DDBJ | mRNA | ||
BC039205 EMBL· GenBank· DDBJ | AAH39205.1 EMBL· GenBank· DDBJ | mRNA |