Q9BT78 · CSN4_HUMAN
- ProteinCOP9 signalosome complex subunit 4
- GeneCOPS4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids406 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. Also involved in the deneddylation of non-cullin subunits such as STON2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1, IRF8/ICSBP and SNAPIN, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell junction | |
Cellular Component | COP9 signalosome | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nuclear speck | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | synaptic vesicle | |
Molecular Function | deNEDDylase activity | |
Biological Process | protein deneddylation | |
Biological Process | protein neddylation | |
Biological Process | regulation of protein neddylation |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCOP9 signalosome complex subunit 4
- Short namesSGN4; Signalosome subunit 4
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BT78
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 308 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000120987 | 2-406 | COP9 signalosome complex subunit 4 | |||
Sequence: AAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLVISRQLLTDFCTHLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ | ||||||
Modified residue | 25 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Interaction
Subunit
Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1 (PubMed:18850735, PubMed:26456823).
In the complex, it probably interacts directly with COPS1, COPS2, COPS3, COPS5, COPS6, COPS7 (COPS7A or COPS7B) and COPS8 (PubMed:18850735).
Interacts with TOR1A; the interaction is direct and associates TOR1A and SNAPIN with the CSN complex (PubMed:21102408).
Interacts with STON2; controls STON2 neddylation levels (PubMed:21102408).
Interacts with ERCC6 (PubMed:26030138).
In the complex, it probably interacts directly with COPS1, COPS2, COPS3, COPS5, COPS6, COPS7 (COPS7A or COPS7B) and COPS8 (PubMed:18850735).
Interacts with TOR1A; the interaction is direct and associates TOR1A and SNAPIN with the CSN complex (PubMed:21102408).
Interacts with STON2; controls STON2 neddylation levels (PubMed:21102408).
Interacts with ERCC6 (PubMed:26030138).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BT78 | BRME1 Q0VDD7 | 2 | EBI-742413, EBI-741210 | |
BINARY | Q9BT78 | COPS6 Q7L5N1 | 20 | EBI-742413, EBI-486838 | |
BINARY | Q9BT78 | FOS P01100 | 2 | EBI-742413, EBI-852851 | |
BINARY | Q9BT78 | KRT19 P08727 | 3 | EBI-742413, EBI-742756 | |
BINARY | Q9BT78 | NUP58 Q9BVL2 | 3 | EBI-742413, EBI-2811583 | |
BINARY | Q9BT78 | PCDHB12 Q9Y5F1 | 3 | EBI-742413, EBI-12012016 | |
BINARY | Q9BT78 | PEX14 O75381 | 3 | EBI-742413, EBI-594898 | |
BINARY | Q9BT78 | STK11 Q15831 | 4 | EBI-742413, EBI-306838 | |
BINARY | Q9BT78 | USHBP1 Q8N6Y0 | 7 | EBI-742413, EBI-739895 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 197-366 | PCI | ||||
Sequence: YRRKFIEAAQRYNELSYKTIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREA |
Sequence similarities
Belongs to the CSN4 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9BT78-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length406
- Mass (Da)46,269
- Last updated2001-06-01 v1
- Checksum4EFF9079058EB609
Q9BT78-2
- Name2
- Differences from canonical
- 335-406: AEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ → HEKPCQRGISRSNHFVSK
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 2 | in Ref. 1; AAD43021 | ||||
Sequence: Missing | ||||||
Sequence conflict | 97 | in Ref. 2; BAA91555 | ||||
Sequence: I → V | ||||||
Alternative sequence | VSP_046336 | 335-406 | in isoform 2 | |||
Sequence: AEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ → HEKPCQRGISRSNHFVSK |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF100757 EMBL· GenBank· DDBJ | AAD43021.1 EMBL· GenBank· DDBJ | mRNA | ||
AK001210 EMBL· GenBank· DDBJ | BAA91555.1 EMBL· GenBank· DDBJ | mRNA | ||
AK024005 EMBL· GenBank· DDBJ | BAG51250.1 EMBL· GenBank· DDBJ | mRNA | ||
AK094238 EMBL· GenBank· DDBJ | BAG52847.1 EMBL· GenBank· DDBJ | mRNA | ||
AC021105 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC073840 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC108473 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471057 EMBL· GenBank· DDBJ | EAX05921.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471057 EMBL· GenBank· DDBJ | EAX05922.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC004302 EMBL· GenBank· DDBJ | AAH04302.1 EMBL· GenBank· DDBJ | mRNA | ||
BC009292 EMBL· GenBank· DDBJ | AAH09292.1 EMBL· GenBank· DDBJ | mRNA | ||
BC093007 EMBL· GenBank· DDBJ | AAH93007.1 EMBL· GenBank· DDBJ | mRNA |