Q9BRG1 · VPS25_HUMAN
- ProteinVacuolar protein-sorting-associated protein 25
- GeneVPS25
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids176 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. The ESCRT-II complex may be involved in facilitating the budding of certain RNA viruses.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | endosome membrane | |
Cellular Component | ESCRT II complex | |
Cellular Component | extracellular exosome | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | protein homodimerization activity | |
Molecular Function | structural molecule activity | |
Biological Process | macroautophagy | |
Biological Process | membrane fission | |
Biological Process | multivesicular body assembly | |
Biological Process | negative regulation of epidermal growth factor-activated receptor activity | |
Biological Process | protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameVacuolar protein-sorting-associated protein 25
- Short nameshVps25
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BRG1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Distributes diffusely throughout the cytoplasm and nucleoplasm, but exhibits a punctate distribution on coexpression with CHMP6.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_048940 | 76 | in dbSNP:rs34494804 | |||
Sequence: I → V | ||||||
Mutagenesis | 124 | Abolishes binding to CHMP6. | ||||
Sequence: V → E | ||||||
Mutagenesis | 126 | Abolishes binding to CHMP6. | ||||
Sequence: T → K |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 136 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000215216 | 1-176 | Vacuolar protein-sorting-associated protein 25 | |||
Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at the mRNA level in kidney, liver, pancreas, and placenta. Lower levels of expression are found in heart, skeletal muscle, brain and lung.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of a complex at least composed of ELL, SNF8/EAP30, VPS25/EAP20 and VPS36/EAP45 (By similarity).
Component of the endosomal sorting complex required for transport II (ESCRT-II), composed of SNF8, VPS36 and 2 copies of VPS25. Interacts with CFTR; the interaction requires misfolded CFTR. Interacts (via C-terminal half) with the ESCRT-III subunit CHMP6 (via N-terminal half)
Component of the endosomal sorting complex required for transport II (ESCRT-II), composed of SNF8, VPS36 and 2 copies of VPS25. Interacts with CFTR; the interaction requires misfolded CFTR. Interacts (via C-terminal half) with the ESCRT-III subunit CHMP6 (via N-terminal half)
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BRG1 | ASPG Q86U10 | 5 | EBI-741945, EBI-19946665 | |
BINARY | Q9BRG1 | B9D2 Q9BPU9 | 3 | EBI-741945, EBI-6958971 | |
BINARY | Q9BRG1 | BEND5 Q7L4P6 | 3 | EBI-741945, EBI-724373 | |
BINARY | Q9BRG1 | BPIFA1 Q9NP55 | 3 | EBI-741945, EBI-953896 | |
BINARY | Q9BRG1 | CHMP6 Q96FZ7 | 8 | EBI-741945, EBI-1049648 | |
BINARY | Q9BRG1 | CRLF3 Q8IUI8 | 12 | EBI-741945, EBI-2872414 | |
BINARY | Q9BRG1 | PICK1 Q9NRD5 | 3 | EBI-741945, EBI-79165 | |
BINARY | Q9BRG1 | REL Q04864 | 4 | EBI-741945, EBI-307352 | |
BINARY | Q9BRG1 | SDCBP2 Q9H190 | 3 | EBI-741945, EBI-742426 | |
BINARY | Q9BRG1 | SEPTIN14 Q6ZU15 | 3 | EBI-741945, EBI-2009297 | |
BINARY | Q9BRG1 | SNF8 Q96H20 | 20 | EBI-741945, EBI-747719 | |
BINARY | Q9BRG1 | SPG21 Q9NZD8 | 3 | EBI-741945, EBI-742688 | |
BINARY | Q9BRG1 | SYCE1 Q8N0S2 | 3 | EBI-741945, EBI-6872807 | |
BINARY | Q9BRG1 | TADA2A O75478 | 3 | EBI-741945, EBI-742268 | |
BINARY | Q9BRG1 | TRIM27 P14373 | 7 | EBI-741945, EBI-719493 | |
BINARY | Q9BRG1 | VPS36 Q86VN1 | 10 | EBI-741945, EBI-4401822 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length176
- Mass (Da)20,748
- Last updated2001-06-01 v1
- Checksum34963A53C3DA4DD5
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB014763 EMBL· GenBank· DDBJ | BAB87804.1 EMBL· GenBank· DDBJ | mRNA | ||
AK312092 EMBL· GenBank· DDBJ | BAG35028.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471152 EMBL· GenBank· DDBJ | EAW60879.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC006282 EMBL· GenBank· DDBJ | AAH06282.1 EMBL· GenBank· DDBJ | mRNA |