Q9BR01 · ST4A1_HUMAN
- ProteinSulfotransferase 4A1
- GeneSULT4A1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids284 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | mitochondrion | |
Molecular Function | identical protein binding | |
Molecular Function | sulfotransferase activity | |
Biological Process | dendrite arborization | |
Biological Process | steroid metabolic process | |
Biological Process | sulfation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSulfotransferase 4A1
- EC number
- Short namesST4A1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ9BR01
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 276 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000085167 | 1-284 | Sulfotransferase 4A1 | |||
Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL | ||||||
Modified residue | 8 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 11 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 205 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in the cerebral cortex and frontal lobe, slightly less in the cerebellum, occipital and temporal lobes, relatively low in the medulla and putamen, and lowest in the spinal cord. No expression detected in the pancreas (PubMed:10698717).
Highly expressed in fetal brain and occipital lobe, slightly less in the whole brain, frontal lobe, hippocampus, and lung, very low expression in cerebellum, medulla oblongata, temporal lobe, testis, kidney and appendix (PubMed:12039030).
Highly expressed in fetal brain and occipital lobe, slightly less in the whole brain, frontal lobe, hippocampus, and lung, very low expression in cerebellum, medulla oblongata, temporal lobe, testis, kidney and appendix (PubMed:12039030).
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q9BR01 | BCL6B Q8N143 | 2 | EBI-6690555, EBI-21899143 | |
BINARY | Q9BR01 | MAPK8IP3 Q9UPT6 | 4 | EBI-6690555, EBI-717887 | |
BINARY | Q9BR01 | PIN1 Q13526 | 4 | EBI-6690555, EBI-714158 | |
BINARY | Q9BR01 | POT1 Q9NUX5 | 2 | EBI-6690555, EBI-752420 | |
BINARY | Q9BR01 | SULT4A1 Q9BR01 | 6 | EBI-6690555, EBI-6690555 | |
BINARY | Q9BR01 | TGM1 P22735 | 3 | EBI-6690555, EBI-2562368 | |
BINARY | Q9BR01-2 | APBB2 Q92870-2 | 3 | EBI-25831443, EBI-21535880 | |
BINARY | Q9BR01-2 | ATXN10 Q9UBB4 | 3 | EBI-25831443, EBI-702390 | |
BINARY | Q9BR01-2 | GFAP P14136 | 3 | EBI-25831443, EBI-744302 | |
BINARY | Q9BR01-2 | HTT P42858 | 15 | EBI-25831443, EBI-466029 | |
BINARY | Q9BR01-2 | JPH3 Q8WXH2 | 3 | EBI-25831443, EBI-1055254 | |
BINARY | Q9BR01-2 | NDUFV2 P19404 | 3 | EBI-25831443, EBI-713665 | |
BINARY | Q9BR01-2 | NOS3 P29474 | 3 | EBI-25831443, EBI-1391623 | |
BINARY | Q9BR01-2 | PMP22 A0A6Q8PF08 | 3 | EBI-25831443, EBI-50433196 | |
BINARY | Q9BR01-2 | SNCA P37840 | 3 | EBI-25831443, EBI-985879 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q9BR01-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length284
- Mass (Da)33,085
- Last updated2002-08-02 v2
- ChecksumA6EA6844B66C400B
Q9BR01-2
- Name2
- Differences from canonical
- 248-284: GRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL → AHCVFARKIFLSW
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F8WE22 | F8WE22_HUMAN | SULT4A1 | 75 |
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 55-56 | in Ref. 10; AAH30665 | ||||
Sequence: KS → P | ||||||
Sequence conflict | 239 | in Ref. 10; AAH22459 | ||||
Sequence: N → S | ||||||
Alternative sequence | VSP_006304 | 248-284 | in isoform 2 | |||
Sequence: GRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL → AHCVFARKIFLSW |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF188698 EMBL· GenBank· DDBJ | AAF61197.1 EMBL· GenBank· DDBJ | mRNA | ||
AF115311 EMBL· GenBank· DDBJ | AAF21970.1 EMBL· GenBank· DDBJ | mRNA | ||
AF176342 EMBL· GenBank· DDBJ | AAK64595.1 EMBL· GenBank· DDBJ | mRNA | ||
AF251263 EMBL· GenBank· DDBJ | AAF98152.1 EMBL· GenBank· DDBJ | mRNA | ||
AL590119 EMBL· GenBank· DDBJ | CAC34872.1 EMBL· GenBank· DDBJ | mRNA | ||
CR456588 EMBL· GenBank· DDBJ | CAG30474.1 EMBL· GenBank· DDBJ | mRNA | ||
AK313048 EMBL· GenBank· DDBJ | BAG35880.1 EMBL· GenBank· DDBJ | mRNA | ||
Z97055 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471138 EMBL· GenBank· DDBJ | EAW73320.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC022459 EMBL· GenBank· DDBJ | AAH22459.1 EMBL· GenBank· DDBJ | mRNA | ||
BC028171 EMBL· GenBank· DDBJ | AAH28171.1 EMBL· GenBank· DDBJ | mRNA | ||
BC030665 EMBL· GenBank· DDBJ | AAH30665.1 EMBL· GenBank· DDBJ | mRNA |