Q99PZ6 · OSPG_SHIFL
- ProteinProtein kinase OspG
- GeneospG
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids196 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. This protein is a kinase that is involved in down-regulation of the host innate response induced by invasive bacteria. Prevents or at least delays host phospho-NF-kappa-B inhibitor alpha (NFKBIA) degradation. Does not phosphorylate E2 enzymes.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | host cell | |
Molecular Function | kinase activity | |
Biological Process | protein autophosphorylation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein kinase OspG
- EC number
- Alternative names
Gene names
Encoded on
- Plasmid pCP301
- Plasmid pWR100
- Plasmid pWR501
- Plasmid pSF5
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Shigella
Accessions
- Primary accessionQ99PZ6
- Secondary accessions
Proteomes
Phenotypes & Variants
Disruption phenotype
Mutant induces a stronger inflammatory reaction upon infection.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 53 | Lack of autophosphorylation. | ||||
Sequence: K → A |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000395877 | 1-196 | Protein kinase OspG | |||
Sequence: MKITSTIIQTPFPFENNNSHAGIVTEPILGKLIGQGSTAEIFEDVNDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGDEASVVIQYGGDVYLRMLRVPGTPLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTGNMLYDKESESLFPIDFRNIYAEYYAATKKDKEIIDRRLQMRTNDFYSLLNRKYL |
Post-translational modification
Autophosphorylated.
Keywords
- PTM
Proteomic databases
Interaction
Subunit
Binds various host ubiquitinated E2 ubiquitin-conjugating enzymes, including UBE2D2 (UBCH5B).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | Q99PZ6 | UBE2D2 P62837 | 3 | EBI-9316527, EBI-347677 | |
XENO | Q99PZ6 | UBE2D3 P61077 | 6 | EBI-9316527, EBI-348268 | |
XENO | Q99PZ6 | UBE2E1 P51965 | 3 | EBI-9316527, EBI-348546 | |
XENO | Q99PZ6 | UBE2E2 Q96LR5 | 2 | EBI-9316527, EBI-2129763 | |
XENO | Q99PZ6 | UBE2K P61086 | 2 | EBI-9316527, EBI-473850 | |
XENO | Q99PZ6 | UBE2L3 P68036 | 3 | EBI-9316527, EBI-711173 | |
XENO | Q99PZ6 | UBE2L3 P68036-1 | 4 | EBI-9316527, EBI-15556257 | |
XENO | Q99PZ6 | UBE2L6 O14933 | 2 | EBI-9316527, EBI-2129974 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length196
- Mass (Da)22,570
- Last updated2001-06-01 v1
- ChecksumE90908CB43BCB28A
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF386526 EMBL· GenBank· DDBJ | AAL72314.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF348706 EMBL· GenBank· DDBJ | AAK18547.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY879342 EMBL· GenBank· DDBJ | AAW64846.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL391753 EMBL· GenBank· DDBJ | CAC05855.1 EMBL· GenBank· DDBJ | Genomic DNA |