Q99MR9 · PPR3A_MOUSE
- ProteinProtein phosphatase 1 regulatory subunit 3A
- GenePpp1r3a
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1089 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Seems to act as a glycogen-targeting subunit for PP1. PP1 is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Plays an important role in glycogen synthesis but is not essential for insulin activation of glycogen synthase.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | protein phosphatase type 1 complex | |
Molecular Function | glycogen binding | |
Molecular Function | protein phosphatase 1 binding | |
Molecular Function | protein serine/threonine phosphatase activity | |
Biological Process | glycogen metabolic process | |
Biological Process | regulation of glycogen biosynthetic process |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProtein phosphatase 1 regulatory subunit 3A
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ99MR9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 1047-1067 | Helical | ||||
Sequence: LLFLIFLATVYYYDLMIGLAF |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000071501 | 1-1089 | Protein phosphatase 1 regulatory subunit 3A | |||
Sequence: MEPAEEPGQISKDNFLEVPNLSDSVCEDEEVKATFKPGFSPQPSRRGSGSSEDMYLDTPTSASRRVSFADSLGFSLVSVKEFDCWELPSVSTDFDLSGDVFHTDEYVLSPLFDLPSSKEKLMEQLQVQKAVLESAEHLPGSSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKEGGKVEFCIRYETSAGTFWSNNNGTNYILVCQKKRKEPEPVKPLEEAPSRQIKGCLKVKSRSKEEPLLAPEENKFETLKFTESYIPTIICSHEDKDDLGANHPNVDDINKKHDEHNGKELDLMINQRLITSQDEKNTFATDTVNFTNKAEGSEKKQAYHEINTDLFMGPLSPSLSAESSLKRDFYHSRSSSPGNEYGHPHSEEIISDMGEKGPSLGDTSSDELMQLELCSKEDLDDNANPANGSGRVCSSFDQRMACGLKNNEAGIKKTGIQDYKYSHGDSTKLEESNASSRDDYAKVDNKKEKQTCLGVNENPSKNFQSVFQTQEGHMGYPKISTEGDKANNQDLTSLLSKDITANTWAVTVDPCPSTNAKRSWREVGSGSNLEPGTSDLSSPRNFSPLTDDHLFQADRENSDSSNPENQNMNTRHRKKWNVLETQSETSETESDIAKHTKEQAEYKDMWEKTDNSRNLKATPTEHLFTCRETECYGLSSLADHGITEKAQAVTAYIIKTTLESTPESASARGKAIIAKLPQETAGNDRPIEVKETAFDPHEGRKDDSHYSLCHGDTAGVIHDNDFERESHLDICNLRVDEMKKEKTTSTCFPQKTYDKEKHGIGSVTSIDEPSQVITGNQKATSKLDLHLGVLPTDRAIFQANADLELLQELSRRTDFNAVPSAFNSDTASASRDSSQVYRHCSKKSVPSYGEEKAVTNTTLQSIPTKSEYNWHPESEVLGHAMSKPEDVFKSSEIMKSGSGGERGGGPILQQKEGSLENSQGPMFFTNEPLENLDEASSENEGLMHSGQSQCYLGDKGLVSSASATVSTQELEAQGRESLLSISTNSKIPYFLLFLIFLATVYYYDLMIGLAFYLFSLYWLYWEGGRQRESVKKK | ||||||
Modified residue | 40 | Phosphoserine; by GSK3 | ||||
Sequence: S | ||||||
Modified residue | 44 | Phosphoserine; by GSK3 | ||||
Sequence: S | ||||||
Modified residue | 48 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 51 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 58 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 67 | Phosphoserine; by PKA | ||||
Sequence: S | ||||||
Modified residue | 821 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylation at Ser-48 by ISPK stimulates the dephosphorylation of glycogen synthase and phosphorylase kinase.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 32-57 | Disordered | ||||
Sequence: KATFKPGFSPQPSRRGSGSSEDMYLD | ||||||
Compositional bias | 41-57 | Polar residues | ||||
Sequence: PQPSRRGSGSSEDMYLD | ||||||
Motif | 64-67 | PP1-binding motif | ||||
Sequence: RRVS | ||||||
Domain | 123-231 | CBM21 | ||||
Sequence: EQLQVQKAVLESAEHLPGSSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKEGGKVEFCIRYETSAGTFWSNNNGTNYILV | ||||||
Region | 385-420 | Disordered | ||||
Sequence: FYHSRSSSPGNEYGHPHSEEIISDMGEKGPSLGDTS | ||||||
Region | 479-501 | Disordered | ||||
Sequence: HGDSTKLEESNASSRDDYAKVDN | ||||||
Compositional bias | 566-601 | Polar residues | ||||
Sequence: PCPSTNAKRSWREVGSGSNLEPGTSDLSSPRNFSPL | ||||||
Region | 566-649 | Disordered | ||||
Sequence: PCPSTNAKRSWREVGSGSNLEPGTSDLSSPRNFSPLTDDHLFQADRENSDSSNPENQNMNTRHRKKWNVLETQSETSETESDIA | ||||||
Region | 949-968 | Disordered | ||||
Sequence: IMKSGSGGERGGGPILQQKE |
Domain
The CBM21 domain is known to be involved in the localization to glycogen and is characteristic of some regulatory subunit of phosphatase complexes.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,089
- Mass (Da)121,435
- Last updated2011-07-27 v2
- Checksum85EC67FD90CC8FD2
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 41-57 | Polar residues | ||||
Sequence: PQPSRRGSGSSEDMYLD | ||||||
Compositional bias | 566-601 | Polar residues | ||||
Sequence: PCPSTNAKRSWREVGSGSNLEPGTSDLSSPRNFSPL | ||||||
Sequence conflict | 959 | in Ref. 1; AAK31072 | ||||
Sequence: G → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF309629 EMBL· GenBank· DDBJ | AAK31072.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF309628 EMBL· GenBank· DDBJ | AAK31072.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH466533 EMBL· GenBank· DDBJ | EDL13902.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC109007 EMBL· GenBank· DDBJ | AAI09008.1 EMBL· GenBank· DDBJ | mRNA | ||
AK084518 EMBL· GenBank· DDBJ | BAC39208.2 EMBL· GenBank· DDBJ | mRNA | ||
AK084719 EMBL· GenBank· DDBJ | BAC39262.2 EMBL· GenBank· DDBJ | mRNA |