Q99MQ1 · BICC1_MOUSE
- ProteinProtein bicaudal C homolog 1
- GeneBicc1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids977 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Putative RNA-binding protein. May be involved in regulating gene expression during embryonic development.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | RNA binding | |
Biological Process | determination of left/right symmetry | |
Biological Process | heart development | |
Biological Process | kidney development | |
Biological Process | negative regulation of canonical Wnt signaling pathway |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameProtein bicaudal C homolog 1
- Short namesBic-C
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ99MQ1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000267715 | 1-977 | Protein bicaudal C homolog 1 | |||
Sequence: MASQSEPGYLAAAQSDPGSNSERSTDSPVAGSEDDLVAAAPLLHSPEWSEERFRVDRKKLEAMLQAAAEGKGRSGEDFFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLPLVLMFELPIAGILQPVPDPNTPSIQHISQTYSVSVSFKQRSRMYGATVTVRGSQNNTNAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNVKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDMKEDIEVDPQVIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLESSGVSIATSLSPASCPAGLACPSLDILASAGLGLTGLGLLGPTTLSLNTSATPNSLLNALNTSVSPLQSSSSGTPSPTLWAPPIANTASATGFSTIPHLMLPSTAQATLTNILLSGVPTYGHTAPSPPPGLTPVDVHINSMQTEGKNISASINGHVQPANMKYGPLSTSSLGEKVLSSNHGDPSMQTAGPEQASPKSNSVEGCNDAFVEVGMPRSPSHSGNAGDLKQMLGASKVSCAKRQTVELLQGTKNSHLHGTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQKSERARLASQPTYVHMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANHVSYKPTMTTAYEGSSLSLSRSSSREHLASGSESDNWRDRNGIGPMGHSEFSAPIGSPKRKQNKSREHYLSSSNYMDCISSLTGSNGCNLNSCFKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELSKNRRKLFEPPNASCTSFLEGGASGRLPRQYHSDIASVSGRW | ||||||
Modified residue | 27 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 32 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 45 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 400 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 614 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 681 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
In the adult, predominantly expressed in heart and kidney. In 8 week old mice, expressed in growing primary oocytes and in the stromal cells of the theca.
Developmental stage
In the developing embryo, first detected at the rostral tip of the primitive streak, Hensen's node, at the late streak stage. At the late headfold stage, expression demarcates the layer of the node from which definitive endoderm and midline mesoderm arises. At 6-8 somite stage observed in the definitive endoderm. Strong expression is detected in the caudal intestinal portal. At 12-15 somite stage is still present in the hindgut, but transient expression is also seen in tissues of neural and mesodermal origins. At 13 dpc present around all sites of cartilage formation, such as cervical vertebral bodies, ribs and Merckel's cartilage. Additionally, expressed in the derivatives of the pleuroperitoneal membrane, the diaphragm and the pericardium, as well as the mesenchyme of the developing lung. Expressed in both the mesonephros and metanephros.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-27 | Polar residues | ||||
Sequence: MASQSEPGYLAAAQSDPGSNSERSTDS | ||||||
Region | 1-43 | Disordered | ||||
Sequence: MASQSEPGYLAAAQSDPGSNSERSTDSPVAGSEDDLVAAAPLL | ||||||
Domain | 134-201 | KH 1 | ||||
Sequence: RVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARI | ||||||
Domain | 286-350 | KH 2 | ||||
Sequence: PVSTQLDIAAQHHLFMMGRNGSNVKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYL | ||||||
Compositional bias | 590-621 | Polar residues | ||||
Sequence: SLGEKVLSSNHGDPSMQTAGPEQASPKSNSVE | ||||||
Region | 590-622 | Disordered | ||||
Sequence: SLGEKVLSSNHGDPSMQTAGPEQASPKSNSVEG | ||||||
Region | 667-702 | Disordered | ||||
Sequence: GTKNSHLHGTDRLLSDPELSATESPLADKKAPGSER | ||||||
Compositional bias | 794-811 | Polar residues | ||||
Sequence: EGSSLSLSRSSSREHLAS | ||||||
Region | 794-848 | Disordered | ||||
Sequence: EGSSLSLSRSSSREHLASGSESDNWRDRNGIGPMGHSEFSAPIGSPKRKQNKSRE | ||||||
Domain | 875-938 | SAM | ||||
Sequence: FKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLLAISELSKN |
Sequence similarities
Belongs to the BicC family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q99MQ1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length977
- Mass (Da)105,037
- Last updated2001-06-01 v1
- Checksum3A5A7B7F2CA84918
Q99MQ1-2
- Name2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
G3X8S6 | G3X8S6_MOUSE | Bicc1 | 951 |
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-27 | Polar residues | ||||
Sequence: MASQSEPGYLAAAQSDPGSNSERSTDS | ||||||
Alternative sequence | VSP_021950 | 1-82 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 276 | in Ref. 2; BAC40732 | ||||
Sequence: H → R | ||||||
Compositional bias | 590-621 | Polar residues | ||||
Sequence: SLGEKVLSSNHGDPSMQTAGPEQASPKSNSVE | ||||||
Compositional bias | 794-811 | Polar residues | ||||
Sequence: EGSSLSLSRSSSREHLAS | ||||||
Alternative sequence | VSP_021951 | 934-977 | in isoform 2 | |||
Sequence: ELSKNRRKLFEPPNASCTSFLEGGASGRLPRQYHSDIASVSGRW → VCDSVQIRNKILRAARIL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF319464 EMBL· GenBank· DDBJ | AAK27347.1 EMBL· GenBank· DDBJ | mRNA | ||
AK089066 EMBL· GenBank· DDBJ | BAC40732.1 EMBL· GenBank· DDBJ | mRNA | ||
BC062174 EMBL· GenBank· DDBJ | AAH62174.1 EMBL· GenBank· DDBJ | mRNA | ||
BC111523 EMBL· GenBank· DDBJ | AAI11524.1 EMBL· GenBank· DDBJ | mRNA |