Q99LE2 · GP146_MOUSE
- ProteinProbable G-protein coupled receptor 146
- GeneGpr146
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids333 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
GPCR receptor required for the regulation of plasma cholesterol levels (PubMed:31778654, PubMed:38503280).
Receptor for cholesin, a gut derived hormone which mediates an inhibitory effect of intestinal cholesterol absorption on hepatic cholesterol synthesis. Cholesin-binding exerts an antagonistic effect by inhibiting PKA signaling and suppressing SREBF2-controlled cholesterol in the liver (PubMed:38503280).
Receptor for cholesin, a gut derived hormone which mediates an inhibitory effect of intestinal cholesterol absorption on hepatic cholesterol synthesis. Cholesin-binding exerts an antagonistic effect by inhibiting PKA signaling and suppressing SREBF2-controlled cholesterol in the liver (PubMed:38503280).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | G protein-coupled receptor activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameProbable G-protein coupled receptor 146
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ99LE2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-22 | Extracellular | ||||
Sequence: MWSCGPLNSTAWAEEPLCRNLR | ||||||
Transmembrane | 23-43 | Helical; Name=1 | ||||
Sequence: LGLWVLSLLYLGAGVPVSLGY | ||||||
Topological domain | 44-64 | Cytoplasmic | ||||
Sequence: NALLVLANLASKNTMTMPDVY | ||||||
Transmembrane | 65-85 | Helical; Name=2 | ||||
Sequence: FVNMAVAGLVLTALAPAYLLG | ||||||
Topological domain | 86-101 | Extracellular | ||||
Sequence: PAHSRWALWSLSSEAH | ||||||
Transmembrane | 102-122 | Helical; Name=3 | ||||
Sequence: VTLLILFNVASLVTMYSTALL | ||||||
Topological domain | 123-145 | Cytoplasmic | ||||
Sequence: SLDYYIERALPRTYMASVYNTRH | ||||||
Transmembrane | 146-166 | Helical; Name=4 | ||||
Sequence: VCGFVWGGAVLTSFSSLLFYI | ||||||
Topological domain | 167-188 | Extracellular | ||||
Sequence: CSHVSSRIAECARMQNTEAADA | ||||||
Transmembrane | 189-209 | Helical; Name=5 | ||||
Sequence: ILVLIGYVVPGLAVLYALALI | ||||||
Topological domain | 210-232 | Cytoplasmic | ||||
Sequence: SRIGKEDTPLDQDTSRLDPSVHR | ||||||
Transmembrane | 233-253 | Helical; Name=6 | ||||
Sequence: LLVATVCTQFGLWTPYYLSLG | ||||||
Topological domain | 254-277 | Extracellular | ||||
Sequence: HTVLTSRGRTVEGHYLGILQVAKD | ||||||
Transmembrane | 278-298 | Helical; Name=7 | ||||
Sequence: LAKFLAFSSSSVTPLLYRYIN | ||||||
Topological domain | 299-333 | Cytoplasmic | ||||
Sequence: KAFPGKLRRLMKKMHCGRRHCSPDPSGIQQVMAQA |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 90 | Decreased affinity for Cholesin; when associated with A-101, A-169, A-179, A-187 and A-265. | ||||
Sequence: R → A | ||||||
Mutagenesis | 101 | Decreased affinity for Cholesin; when associated with A-90, A-169, A-179, A-187 and A-265. | ||||
Sequence: H → A | ||||||
Mutagenesis | 169 | Decreased affinity for Cholesin; when associated with A-90, A-101, A-179, A-187 and A-265. | ||||
Sequence: H → A | ||||||
Mutagenesis | 179 | Decreased affinity for Cholesin; when associated with A-90, A-101, A-169, A-187 and A-265. | ||||
Sequence: R → A | ||||||
Mutagenesis | 187 | Decreased affinity for Cholesin; when associated with A-90, A-101, A-169, A-179 and A-265. | ||||
Sequence: D → A | ||||||
Mutagenesis | 265 | Decreased affinity for Cholesin; when associated with A-90, A-101, A-169, A-179 and A-187. | ||||
Sequence: E → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 13 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000069623 | 1-333 | Probable G-protein coupled receptor 146 | |||
Sequence: MWSCGPLNSTAWAEEPLCRNLRLGLWVLSLLYLGAGVPVSLGYNALLVLANLASKNTMTMPDVYFVNMAVAGLVLTALAPAYLLGPAHSRWALWSLSSEAHVTLLILFNVASLVTMYSTALLSLDYYIERALPRTYMASVYNTRHVCGFVWGGAVLTSFSSLLFYICSHVSSRIAECARMQNTEAADAILVLIGYVVPGLAVLYALALISRIGKEDTPLDQDTSRLDPSVHRLLVATVCTQFGLWTPYYLSLGHTVLTSRGRTVEGHYLGILQVAKDLAKFLAFSSSSVTPLLYRYINKAFPGKLRRLMKKMHCGRRHCSPDPSGIQQVMAQA | ||||||
Glycosylation | 8 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length333
- Mass (Da)36,572
- Last updated2011-07-27 v2
- ChecksumC51690838AB42988
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 192 | in Ref. 1; BAC40804/BAE32614 and 3; AAH03323 | ||||
Sequence: L → V | ||||||
Sequence conflict | 283 | in Ref. 1; BAC39803 | ||||
Sequence: A → P |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK046512 EMBL· GenBank· DDBJ | BAC32762.1 EMBL· GenBank· DDBJ | mRNA | ||
AK087100 EMBL· GenBank· DDBJ | BAC39803.1 EMBL· GenBank· DDBJ | mRNA | ||
AK089232 EMBL· GenBank· DDBJ | BAC40804.1 EMBL· GenBank· DDBJ | mRNA | ||
AK154478 EMBL· GenBank· DDBJ | BAE32614.1 EMBL· GenBank· DDBJ | mRNA | ||
AK137454 EMBL· GenBank· DDBJ | BAE23357.1 EMBL· GenBank· DDBJ | mRNA | ||
AK154708 EMBL· GenBank· DDBJ | BAE32777.1 EMBL· GenBank· DDBJ | mRNA | ||
AK155876 EMBL· GenBank· DDBJ | BAE33478.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466529 EMBL· GenBank· DDBJ | EDL19154.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC003323 EMBL· GenBank· DDBJ | AAH03323.1 EMBL· GenBank· DDBJ | mRNA |