Q99JI6 · RAP1B_MOUSE
- ProteinRas-related protein Rap-1b
- GeneRap1b
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids184 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GTP-binding protein that possesses intrinsic GTPase activity. Contributes to the polarizing activity of KRIT1 and CDH5 in the establishment and maintenance of correct endothelial cell polarity and vascular lumen. Required for the localization of phosphorylated PRKCZ, PARD3 and TIAM1 to the cell junction. Plays a role in the establishment of basal endothelial barrier function (By similarity).
Catalytic activity
- GTP + H2O = GDP + H+ + phosphate
Activity regulation
Activated by guanine nucleotide-exchange factor (GEF) EPAC2 in a cAMP-dependent manner.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRas-related protein Rap-1b
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ99JI6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: May shuttle between plasma membrane and cytosol (By similarity).
Presence of KRIT1 and CDH5 is required for its localization to the cell junction (By similarity).
Presence of KRIT1 and CDH5 is required for its localization to the cell junction (By similarity).
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000030211 | 1-181 | Ras-related protein Rap-1b | |||
Sequence: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSC | ||||||
Modified residue | 39 | ADP-ribosylserine; by botulinum toxin | ||||
Sequence: S | ||||||
Modified residue | 179 | Phosphoserine; by PKA | ||||
Sequence: S | ||||||
Modified residue | 181 | Cysteine methyl ester | ||||
Sequence: C | ||||||
Lipidation | 181 | S-geranylgeranyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000030212 | 182-184 | Removed in mature form | |||
Sequence: QLL |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Heterodimer with RAP1GAP (By similarity).
Interacts with EPAC2 (By similarity).
Interacts with SGSM1 (By similarity).
Interacts with SGSM2 (By similarity).
Interacts with SGSM3 (By similarity).
Interacts with KRIT1 (By similarity).
Interacts with RAP1GDS1 (By similarity).
Interacts with EPAC2 (By similarity).
Interacts with SGSM1 (By similarity).
Interacts with SGSM2 (By similarity).
Interacts with SGSM3 (By similarity).
Interacts with KRIT1 (By similarity).
Interacts with RAP1GDS1 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 25-67 | Interaction with KRIT1 | ||||
Sequence: QGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAM | ||||||
Motif | 32-40 | Effector region | ||||
Sequence: YDPTIEDSY |
Sequence similarities
Belongs to the small GTPase superfamily. Ras family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length184
- Mass (Da)20,825
- Last updated2004-05-10 v2
- ChecksumCE976895E5965224
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1W2P777 | A0A1W2P777_MOUSE | Rap1b | 53 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 56 | in Ref. 2; AAK14823 | ||||
Sequence: L → W | ||||||
Sequence conflict | 61 | in Ref. 2; AAK14823 | ||||
Sequence: T → Q |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC033382 EMBL· GenBank· DDBJ | AAH33382.2 EMBL· GenBank· DDBJ | mRNA | ||
BC052480 EMBL· GenBank· DDBJ | AAH52480.1 EMBL· GenBank· DDBJ | mRNA | ||
M79314 EMBL· GenBank· DDBJ | AAK14823.1 EMBL· GenBank· DDBJ | mRNA |