Q99JI1 · MSTN1_MOUSE
- ProteinMusculoskeletal embryonic nuclear protein 1
- GeneMustn1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for chondrocyte development and proliferation (PubMed:19410023).
Plays a role in myoblast differentiation and fusion (PubMed:20130207).
Modulates skeletal muscle extracellular matrix composition (PubMed:38458566).
Plays a role in skeletal muscle function (PubMed:38094159).
Plays a role in glucose homeostasis (PubMed:37170065).
Plays a role in myoblast differentiation and fusion (PubMed:20130207).
Modulates skeletal muscle extracellular matrix composition (PubMed:38458566).
Plays a role in skeletal muscle function (PubMed:38094159).
Plays a role in glucose homeostasis (PubMed:37170065).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular region | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Biological Process | chondrocyte differentiation | |
Biological Process | chondrocyte proliferation | |
Biological Process | glucose homeostasis | |
Biological Process | muscle organ development | |
Biological Process | positive regulation of chondrocyte differentiation | |
Biological Process | positive regulation of chondrocyte proliferation | |
Biological Process | positive regulation of gene expression | |
Biological Process | positive regulation of myoblast differentiation | |
Biological Process | positive regulation of proteoglycan biosynthetic process | |
Biological Process | tissue regeneration |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMusculoskeletal embryonic nuclear protein 1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ99JI1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted from smooth muscle cells into the muscle extracellular space.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
In one study, knockout mice show no effect on glucose tolerance or muscle function with altered extracellular matrix composition (PubMed:38458566).
In another study, conditional knockdown in skeletal muscle results in increased glucose tolerance in 2-month old male mice with increased expression of Slc2a1/Glut1, Slc2a10/Glut10 and Mup1 and decreased expression of Ostn (PubMed:37170065).
This effect is no longer seen at 4 months and females do not show any difference (PubMed:37170065).
Conditional knockdown in skeletal muscle in another study also results in increased vertical hindlimb force at 4 months with a significant decrease of type I and type IIa muscle fibers and a significant increase of type IIb muscle fibers (PubMed:38094159).
In another study, conditional knockdown in skeletal muscle results in increased glucose tolerance in 2-month old male mice with increased expression of Slc2a1/Glut1, Slc2a10/Glut10 and Mup1 and decreased expression of Ostn (PubMed:37170065).
This effect is no longer seen at 4 months and females do not show any difference (PubMed:37170065).
Conditional knockdown in skeletal muscle in another study also results in increased vertical hindlimb force at 4 months with a significant decrease of type I and type IIa muscle fibers and a significant increase of type IIb muscle fibers (PubMed:38094159).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 10 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000299448 | 1-82 | Musculoskeletal embryonic nuclear protein 1 | |||
Sequence: MSEAGTPEGPIKKKRPPVKEEDLKGARGTLAKNQDIKSKTYQVMRDYEQAGSAAPSVFSRNRTGTETVFEKPKEGPAKSVFG | ||||||
Modified residue | 2 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 6 | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in vascular smooth muscle cells (at protein level) (PubMed:38458566).
In the embryo, expressed in areas of active chondrogenesis including limb buds, branchial arches and tail bud (PubMed:19410023, PubMed:20130207).
Also expressed in the embryo in somites, in the perichondrium of developing ribs and intercostal muscles, and in various dorsal skeletal muscles of the back including the neck trapezius muscles (PubMed:20130207).
Expressed in adult skeletal muscle (PubMed:20130207).
Transiently increased expression in the gastrocnemius muscle 1 day after hindlimb muscle reloading following 10 days of muscle unloading (PubMed:38458566).
In the embryo, expressed in areas of active chondrogenesis including limb buds, branchial arches and tail bud (PubMed:19410023, PubMed:20130207).
Also expressed in the embryo in somites, in the perichondrium of developing ribs and intercostal muscles, and in various dorsal skeletal muscles of the back including the neck trapezius muscles (PubMed:20130207).
Expressed in adult skeletal muscle (PubMed:20130207).
Transiently increased expression in the gastrocnemius muscle 1 day after hindlimb muscle reloading following 10 days of muscle unloading (PubMed:38458566).
Developmental stage
In skeletal muscle, expressed at low levels during embryogenesis and up to postnatal month 2 with a 5-fold increase at 3 months.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-35 | Disordered | ||||
Sequence: MSEAGTPEGPIKKKRPPVKEEDLKGARGTLAKNQD | ||||||
Compositional bias | 8-28 | Basic and acidic residues | ||||
Sequence: EGPIKKKRPPVKEEDLKGARG | ||||||
Motif | 10-18 | Nuclear localization signal | ||||
Sequence: PIKKKRPPV | ||||||
Region | 50-82 | Disordered | ||||
Sequence: AGSAAPSVFSRNRTGTETVFEKPKEGPAKSVFG |
Sequence similarities
Belongs to the MUSTN1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length82
- Mass (Da)8,941
- Last updated2001-06-01 v1
- Checksum11F30DF130D27E36
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 8-28 | Basic and acidic residues | ||||
Sequence: EGPIKKKRPPVKEEDLKGARG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ277212 EMBL· GenBank· DDBJ | CAC34580.1 EMBL· GenBank· DDBJ | mRNA | ||
AK003360 EMBL· GenBank· DDBJ | BAC25032.1 EMBL· GenBank· DDBJ | mRNA | ||
AK003945 EMBL· GenBank· DDBJ | BAC25061.1 EMBL· GenBank· DDBJ | mRNA | ||
BC116939 EMBL· GenBank· DDBJ | AAI16940.1 EMBL· GenBank· DDBJ | mRNA | ||
BC116941 EMBL· GenBank· DDBJ | AAI16942.1 EMBL· GenBank· DDBJ | mRNA |