Q99J08 · S14L2_MOUSE
- ProteinSEC14-like protein 2
- GeneSec14l2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids403 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Molecular Function | enzyme activator activity | |
Molecular Function | lipid binding | |
Molecular Function | transferase activity, transferring alkyl or aryl (other than methyl) groups | |
Biological Process | positive regulation of cholesterol biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameSEC14-like protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ99J08
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000210756 | 1-403 | SEC14-like protein 2 | |||
Sequence: MSGRVGDLSPKQEEALAKFRENVQDVLPTLPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKIISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLLQECIQQTTKLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEHTVQVSRGSSHQVEYEILFPGCVLRWQFMSEGSDVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHMVPEDGTLTCSEPGIYVLRFDNTYSFIHAKKVSFTVEVLLPDKAAEEKMNQQGADTPK | ||||||
Modified residue | 11 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 51 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 253 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 257 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 393 | N6-succinyllysine | ||||
Sequence: K |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 76-249 | CRAL-TRIO | ||||
Sequence: PPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLLQECIQQTTKLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQLPVEYGGTMTDPD | ||||||
Domain | 275-383 | GOLD | ||||
Sequence: KQQYEHTVQVSRGSSHQVEYEILFPGCVLRWQFMSEGSDVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHMVPEDGTLTCSEPGIYVLRFDNTYSFIHAKKVSFTVEV |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length403
- Mass (Da)46,300
- Last updated2001-06-01 v1
- Checksum42E0BBAFE3004841
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC005759 EMBL· GenBank· DDBJ | AAH05759.1 EMBL· GenBank· DDBJ | mRNA |