Q99966 · CITE1_HUMAN
- ProteinCbp/p300-interacting transactivator 1
- GeneCITED1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids193 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional coactivator of the p300/CBP-mediated transcription complex. Enhances SMAD-mediated transcription by strengthening the functional link between the DNA-binding SMAD transcription factors and the p300/CBP transcription coactivator complex. Stimulates estrogen-dependent transactivation activity mediated by estrogen receptors signaling; stabilizes the interaction of estrogen receptor ESR1 and histone acetyltransferase EP300. Positively regulates TGF-beta signaling through its association with the SMAD/p300/CBP-mediated transcriptional coactivator complex. Induces transcription from estrogen-responsive promoters and protection against cell death. Potentiates EGR2-mediated transcriptional activation activity from the ERBB2 promoter. Acts as an inhibitor of osteoblastic mineralization through a cAMP-dependent parathyroid hormone receptor signaling. May play a role in pigmentation of melanocytes. Associates with chromatin to the estrogen-responsive TGF-alpha promoter region in a estrogen-dependent manner.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCbp/p300-interacting transactivator 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ99966
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 16 | Strongly reduces phosphorylation but does not interfere with its NES-dependent nuclear export; when associated with A-63; A-67; A-71 and A-137. | ||||
Sequence: S → A | ||||||
Mutagenesis | 63 | Strongly reduces phosphorylation but does not interfere with its NES-dependent nuclear export; when associated with A-16; A-67; A-71 and A-137. | ||||
Sequence: S → A | ||||||
Mutagenesis | 67 | Strongly reduces phosphorylation but does not interfere with its NES-dependent nuclear export; when associated with A-16; A-63; A-71 and A-137. | ||||
Sequence: S → A | ||||||
Mutagenesis | 71 | Strongly reduces phosphorylation but does not interfere with its NES-dependent nuclear export; when associated with A-16; A-63; A-67 and A-137. | ||||
Sequence: S → A | ||||||
Mutagenesis | 91 | Does not change subcellular localization; when associated with A-95. | ||||
Sequence: L → A | ||||||
Mutagenesis | 95 | Does not change subcellular localization; when associated with A-91. | ||||
Sequence: M → A | ||||||
Natural variant | VAR_053038 | 96 | in dbSNP:rs3012627 | |||
Sequence: H → Q | ||||||
Mutagenesis | 137 | Strongly reduces phosphorylation; when associated with A-16; A-63; A-67 and A-71. | ||||
Sequence: S → A | ||||||
Mutagenesis | 155-156 | Does not inhibit interaction with ESR1 and ER-coactivation activity. | ||||
Sequence: EE → AA | ||||||
Mutagenesis | 157-158 | Inhibits interaction with ESR1 and ER-coactivation activity. | ||||
Sequence: VL → AA | ||||||
Mutagenesis | 159-160 | Does not inhibit interaction with ESR1 and ER-coactivation activity. | ||||
Sequence: MS → AA | ||||||
Mutagenesis | 161-162 | Does not inhibit interaction with ESR1 and ER-coactivation activity. | ||||
Sequence: LV → AA | ||||||
Mutagenesis | 163-164 | Does not inhibit interaction with ESR1 and ER-coactivation activity. | ||||
Sequence: VE → AA | ||||||
Mutagenesis | 165 | Does not inhibit interaction with ESR1 and ER-coactivation activity. Localizes mainly in the nucleus; when associated with A-167. | ||||
Sequence: L → A | ||||||
Mutagenesis | 166-167 | Does not inhibit interaction with ESR1 and ER-coactivation activity. Localizes mainly in the nucleus; when associated with A-165. | ||||
Sequence: GL → AA | ||||||
Mutagenesis | 176 | Does not change subcellular localization; when associated with A-178. | ||||
Sequence: L → A | ||||||
Mutagenesis | 178 | Does not change subcellular localization; when associated with A-176. | ||||
Sequence: L → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 180 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000144724 | 1-193 | Cbp/p300-interacting transactivator 1 | |||
Sequence: MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC |
Post-translational modification
Phosphorylated. Phosphorylation changes in a cell cycle-dependent manner and reduces its transcriptional coactivator activity.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed only in melanocytes and testis.
Induction
Up-regulated by GPR39 in neuronal cells.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts (via C-terminus) with CREBBP. Interacts with EGR2 (By similarity).
Homodimer. Binds to RBM14. Interacts (via N-terminus) with HSPA8; the interaction suppresses the association of CITED1 with p300/CBP and SMAD-mediated transcription transactivation. Interacts (via C-terminus) with TOX3 (via HGM box); the interaction increases estrogen-response element (ERE)-dependent transcription and protection against cell death. Interacts with ESR1; the interaction occurs in a estrogen-dependent manner (By similarity).
Interacts (unphosphorylated form preferentially and via C-terminus) with EP300
Homodimer. Binds to RBM14. Interacts (via N-terminus) with HSPA8; the interaction suppresses the association of CITED1 with p300/CBP and SMAD-mediated transcription transactivation. Interacts (via C-terminus) with TOX3 (via HGM box); the interaction increases estrogen-response element (ERE)-dependent transcription and protection against cell death. Interacts with ESR1; the interaction occurs in a estrogen-dependent manner (By similarity).
Interacts (unphosphorylated form preferentially and via C-terminus) with EP300
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q99966 | ATF2 P15336 | 2 | EBI-2624951, EBI-1170906 | |
BINARY | Q99966 | CASP6 P55212 | 3 | EBI-2624951, EBI-718729 | |
BINARY | Q99966 | CCK P06307 | 3 | EBI-2624951, EBI-6624398 | |
BINARY | Q99966 | ESR1 P03372 | 3 | EBI-2624951, EBI-78473 | |
BINARY | Q99966 | FKBP1A Q0VDC6 | 3 | EBI-2624951, EBI-10226858 | |
BINARY | Q99966 | JUN P05412 | 2 | EBI-2624951, EBI-852823 | |
BINARY | Q99966 | LAMP2 P13473-2 | 3 | EBI-2624951, EBI-21591415 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-26 | Disordered | ||||
Sequence: MPTTSRPALDVKGGTSPAKEDANQEM | ||||||
Region | 50-88 | Disordered | ||||
Sequence: VASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPA | ||||||
Compositional bias | 55-72 | Polar residues | ||||
Sequence: TKASGAPTSSSGSPIGSP | ||||||
Region | 106-147 | Disordered | ||||
Sequence: GMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAI | ||||||
Motif | 158-167 | Nuclear export signal | ||||
Sequence: LMSLVVELGL |
Sequence similarities
Belongs to the CITED family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q99966-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length193
- Mass (Da)19,896
- Last updated2010-05-18 v2
- Checksum9B0CF50CA639ECCB
Q99966-2
- Name2
- Differences from canonical
- 1-1: M → MEPSAQQLQLAASLPANLSNFCQGSEM
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_039897 | 1 | in isoform 2 | |||
Sequence: M → MEPSAQQLQLAASLPANLSNFCQGSEM | ||||||
Compositional bias | 55-72 | Polar residues | ||||
Sequence: TKASGAPTSSSGSPIGSP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U65092 EMBL· GenBank· DDBJ | AAC51113.1 EMBL· GenBank· DDBJ | mRNA | ||
AB451286 EMBL· GenBank· DDBJ | BAG70100.1 EMBL· GenBank· DDBJ | mRNA | ||
AB451418 EMBL· GenBank· DDBJ | BAG70232.1 EMBL· GenBank· DDBJ | mRNA | ||
AL135749 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471213 EMBL· GenBank· DDBJ | EAW71819.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC004240 EMBL· GenBank· DDBJ | AAH04240.1 EMBL· GenBank· DDBJ | mRNA | ||
N30508 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |