Q99961 · SH3G1_HUMAN
- ProteinEndophilin-A2
- GeneSH3GL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids368 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 15-16 | Breakpoint for translocation to form KMT2A/MLL1-EEN oncogene | ||||
Sequence: QL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | anchoring junction | |
Cellular Component | cell projection | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | early endosome membrane | |
Cellular Component | glutamatergic synapse | |
Cellular Component | podosome | |
Cellular Component | presynapse | |
Molecular Function | cadherin binding | |
Molecular Function | identical protein binding | |
Molecular Function | lipid binding | |
Biological Process | central nervous system development | |
Biological Process | signal transduction | |
Biological Process | synaptic vesicle uncoating |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEndophilin-A2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ99961
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Early endosome membrane ; Peripheral membrane protein
Note: Associated with postsynaptic endosomes in hippocampal neurons.
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 399 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000146744 | 1-368 | UniProt | Endophilin-A2 | |||
Sequence: MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ | |||||||
Modified residue (large scale data) | 286 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 287 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 288 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 288 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 291 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 292 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 292 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 298 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 298 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 315 | UniProt | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Tissue specificity
Ubiquitous. Higher expression in pancreas, placenta, prostate, testis and uterus.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with ARC (By similarity).
Interacts with SYNJ1 and DNM1. Interacts with PDCD6IP. Interacts with BIN2
Interacts with SYNJ1 and DNM1. Interacts with PDCD6IP. Interacts with BIN2
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-21 | Membrane-binding amphipathic helix | ||||
Sequence: MSVAGLKKQFYKASQLVSEKV | ||||||
Domain | 18-249 | BAR | ||||
Sequence: SEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASS | ||||||
Region | 60-87 | Required for dimerization upon membrane association | ||||
Sequence: PNPASRAKLTMLNTVSKIRGQVKNPGYP | ||||||
Coiled coil | 145-250 | |||||
Sequence: NLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSR | ||||||
Region | 218-254 | Interaction with ARC | ||||
Sequence: LVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKRE | ||||||
Compositional bias | 244-265 | Basic and acidic residues | ||||
Sequence: MREASSRPKREYKPKPREPFDL | ||||||
Region | 244-308 | Disordered | ||||
Sequence: MREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQ | ||||||
Compositional bias | 272-298 | Polar residues | ||||
Sequence: NGGFPCTTAPKIAASSSFRSSDKPIRT | ||||||
Domain | 306-365 | SH3 | ||||
Sequence: LDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVP |
Domain
An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.
Sequence similarities
Belongs to the endophilin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q99961-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length368
- Mass (Da)41,490
- Last updated1997-05-01 v1
- Checksum6E5BE978BC955077
Q99961-2
- Name2
- Differences from canonical
- 63-110: Missing
Q99961-3
- Name3
- Differences from canonical
- 80-143: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_045837 | 63-110 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_047037 | 80-143 | in isoform 3 | |||
Sequence: Missing | ||||||
Compositional bias | 244-265 | Basic and acidic residues | ||||
Sequence: MREASSRPKREYKPKPREPFDL | ||||||
Compositional bias | 272-298 | Polar residues | ||||
Sequence: NGGFPCTTAPKIAASSSFRSSDKPIRT | ||||||
Sequence conflict | 316 | in Ref. 5; BAG61213 | ||||
Sequence: D → G |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X99656 EMBL· GenBank· DDBJ | CAA67970.1 EMBL· GenBank· DDBJ | mRNA | ||
U65999 EMBL· GenBank· DDBJ | AAB86800.1 EMBL· GenBank· DDBJ | mRNA | ||
AF190465 EMBL· GenBank· DDBJ | AAF04290.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK299166 EMBL· GenBank· DDBJ | BAG61213.1 EMBL· GenBank· DDBJ | mRNA | ||
AK097616 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AC007292 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC011498 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC001270 EMBL· GenBank· DDBJ | AAH01270.1 EMBL· GenBank· DDBJ | mRNA |