Q99650 · OSMR_HUMAN
- ProteinOncostatin-M-specific receptor subunit beta
- GeneOSMR
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids979 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | external side of plasma membrane | |
Cellular Component | oncostatin-M receptor complex | |
Cellular Component | plasma membrane | |
Cellular Component | receptor complex | |
Molecular Function | ciliary neurotrophic factor receptor binding | |
Molecular Function | cytokine binding | |
Molecular Function | cytokine receptor activity | |
Molecular Function | growth factor binding | |
Biological Process | cytokine-mediated signaling pathway | |
Biological Process | oncostatin-M-mediated signaling pathway | |
Biological Process | positive regulation of acute inflammatory response | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | response to cytokine |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOncostatin-M-specific receptor subunit beta
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ99650
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 28-740 | Extracellular | ||||
Sequence: ERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSIRNNFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSGQNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSSSELHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTEGGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFRIYGLSTKRIACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTSAGEGPSATFTKVTTPDEHSSM | ||||||
Transmembrane | 741-761 | Helical | ||||
Sequence: LIHILLPMVFCVLLIMVMCYL | ||||||
Topological domain | 762-979 | Cytoplasmic | ||||
Sequence: KSQWIKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKNYMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPGEHYC |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Amyloidosis, primary localized cutaneous, 1 (PLCA1)
- Note
- DescriptionA primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins.
- See alsoMIM:105250
Natural variants in PLCA1
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_043513 | 618 | G>A | in PLCA1; dbSNP:rs63750560 | |
VAR_065810 | 647 | D>V | in PLCA1; dbSNP:rs387906821 | |
VAR_043514 | 691 | I>T | in PLCA1; dbSNP:rs63750567 | |
VAR_065811 | 694 | P>L | in PLCA1; dbSNP:rs387906822 | |
VAR_065812 | 697 | K>T | in PLCA1; dbSNP:rs387906823 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_043512 | 187 | in dbSNP:rs34675408 | |||
Sequence: H → Q | ||||||
Natural variant | VAR_028972 | 210 | in dbSNP:rs17855841 | |||
Sequence: G → W | ||||||
Natural variant | VAR_028973 | 527 | in dbSNP:rs10941412 | |||
Sequence: E → K | ||||||
Natural variant | VAR_028974 | 553 | in dbSNP:rs2278329 | |||
Sequence: D → N | ||||||
Natural variant | VAR_043513 | 618 | in PLCA1; dbSNP:rs63750560 | |||
Sequence: G → A | ||||||
Natural variant | VAR_065810 | 647 | in PLCA1; dbSNP:rs387906821 | |||
Sequence: D → V | ||||||
Natural variant | VAR_043514 | 691 | in PLCA1; dbSNP:rs63750567 | |||
Sequence: I → T | ||||||
Natural variant | VAR_065811 | 694 | in PLCA1; dbSNP:rs387906822 | |||
Sequence: P → L | ||||||
Natural variant | VAR_065812 | 697 | in PLCA1; dbSNP:rs387906823 | |||
Sequence: K → T | ||||||
Natural variant | VAR_028975 | 936 | in dbSNP:rs3749737 | |||
Sequence: P → S | ||||||
Natural variant | VAR_043515 | 959 | in dbSNP:rs34080825 | |||
Sequence: P → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,104 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Signal | 1-27 | UniProt | |||||
Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLA | |||||||
Chain | PRO_0000259759 | 28-979 | UniProt | Oncostatin-M-specific receptor subunit beta | |||
Sequence: ERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSIRNNFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSGQNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSSSELHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTEGGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFRIYGLSTKRIACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTSAGEGPSATFTKVTTPDEHSSMLIHILLPMVFCVLLIMVMCYLKSQWIKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKNYMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPGEHYC | |||||||
Glycosylation | 163 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Disulfide bond | 245↔255 | UniProt | |||||
Sequence: CETEDFKTLHC | |||||||
Glycosylation | 326 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 380 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 446 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 580 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Modified residue (large scale data) | 800 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 826 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 826 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 828 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 837 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 839 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 860 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 861 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 877 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 889 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 889 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 945 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 978 | PRIDE | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at relatively high levels in all neural cells as well as fibroblast and epithelial cells (PubMed:8999038).
Induction
Up-regulated by IFNG/IFN-gamma (PubMed:15184896, PubMed:21261663).
Up-regulated by bacterial lipopolysaccharides (LPS) (PubMed:15184896).
Up-regulated by triacylated lipoprotein (Pam3Cys) (PubMed:21261663).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q99650 | ATP5IF1 Q9UII2 | 4 | EBI-2804080, EBI-718459 | |
BINARY | Q99650 | GPRC5D Q9NZD1 | 3 | EBI-2804080, EBI-13067820 | |
BINARY | Q99650 | HSPA9 P38646 | 4 | EBI-2804080, EBI-354932 | |
BINARY | Q99650 | IL6ST P40189 | 2 | EBI-2804080, EBI-1030834 | |
BINARY | Q99650 | JAK1 P23458 | 2 | EBI-2804080, EBI-1383438 | |
BINARY | Q99650 | LHX2 P50458 | 3 | EBI-2804080, EBI-12179869 | |
BINARY | Q99650 | NDUFS1 P28331 | 4 | EBI-2804080, EBI-1043922 | |
BINARY | Q99650 | NDUFS2 O75306 | 4 | EBI-2804080, EBI-1224806 | |
BINARY | Q99650 | SGTB Q96EQ0 | 3 | EBI-2804080, EBI-744081 | |
BINARY | Q99650 | SLC10A6 Q3KNW5 | 3 | EBI-2804080, EBI-18159983 | |
BINARY | Q99650 | UBQLN2 Q9UHD9 | 3 | EBI-2804080, EBI-947187 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 335-428 | Fibronectin type-III 1 | ||||
Sequence: NPFSVNFENVNATNAIMTWKVHSIRNNFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSGQNFTTLEA | ||||||
Motif | 415-419 | WSXWS motif | ||||
Sequence: WSEWS | ||||||
Domain | 433-528 | Fibronectin type-III 2 | ||||
Sequence: APDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSSSELHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISADPEN | ||||||
Domain | 529-623 | Fibronectin type-III 3 | ||||
Sequence: KEVEEERIAGTEGGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFRIYGLSTKRIACLLEKKTGYSQEL | ||||||
Domain | 625-736 | Fibronectin type-III 4 | ||||
Sequence: PSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYHVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTSAGEGPSATFTKVTTPDE | ||||||
Motif | 770-778 | Box 1 motif | ||||
Sequence: CYPDIPDPY |
Domain
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q99650-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length979
- Mass (Da)110,509
- Last updated1997-05-01 v1
- Checksum179852CA3D90D9EF
Q99650-2
- Name2
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U60805 EMBL· GenBank· DDBJ | AAC50946.1 EMBL· GenBank· DDBJ | mRNA | ||
BC010943 EMBL· GenBank· DDBJ | AAH10943.1 EMBL· GenBank· DDBJ | mRNA | ||
BC063468 EMBL· GenBank· DDBJ | AAH63468.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BC125209 EMBL· GenBank· DDBJ | AAI25210.1 EMBL· GenBank· DDBJ | mRNA | ||
BC125210 EMBL· GenBank· DDBJ | AAI25211.1 EMBL· GenBank· DDBJ | mRNA |