Q96WV5 · COPA_SCHPO
- ProteinPutative coatomer subunit alpha
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1207 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COPI vesicle coat | |
Cellular Component | cytoplasm | |
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi membrane | |
Molecular Function | cargo receptor activity | |
Molecular Function | structural molecule activity | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | intra-Golgi vesicle-mediated transport | |
Biological Process | intracellular protein transport | |
Biological Process | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePutative coatomer subunit alpha
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Taphrinomycotina > Schizosaccharomycetes > Schizosaccharomycetales > Schizosaccharomycetaceae > Schizosaccharomyces
Accessions
- Primary accessionQ96WV5
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000316543 | 1-1207 | Putative coatomer subunit alpha | |||
Sequence: MEMLTKFESRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFDGHDGPVRGIAFHPTQPLFVSGGDDYKVNVWNYKSRKLLFSLCGHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILTGHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRMKNAAPVSMSLEDQLAQAHNSISNDLFGSTDAIVKFVLEGHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEVDTCRGHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQTFRRDNDRFWFITVHPKLNLFAAAHDSGVMVFKLERERPAHALNINTLLYVNKEKSIVSYDLLRAQSTTVASVKHLGSAWLPPRSLSYNPAEKVALLTSSADNGVYELVNVSSRSNSLPLKDNIKGPGDDAIFVARNRFAVFSRSDQTIEIKDLSNKVTKTIQLPEKTRDIFFAGMGHVLLSTATQVHLFDLQQKKIVSSFNANRVKYVVWSNDNSQAALLGKHYVYIVKKNLELITSIHETIRIKSAVWVENNVLLYATLDHLKYALMSGDTGVIKTLESTLYLVKAKGNMVFALNRAAEPVSFEIDPTEYLFKLALLRKDYEQVLHLIQNSNLVGQAIIAYLQKKGYPEIALQFVEDPSTRFELALECGNLETALELARTIDRPEVWSRLASDAMSYGNHKIAEITFQKLRYFEKLSFLYLITGNAEKLQKMAIIAEKRNDTLSLFQNSLYLNEVESRINILEQAGMYPIAYLTAKSNGLEEKAQQILSHCNKTEEEIKLPSLGSAFTTPVPVNETYTHNWPLLDTSHSTFEKSLQERMEQLAIERQEEQESEEEYEEVEQSLMDVVDEMSDLAESVPEEEVDGWEVEDLAPEEAVNDVVDDASAFVGADEIFLWKRNSPLAADHIAAGDFESAMKILNKQVGAINFSPLKTRFLEIYTASRVYLPTISGLDPLVSYVRRNAETAERSQALPFITRNLASIKSHELHEAYRLVKANKILEAQICFRSIIYLALTTVANSEEEADEISALIDECCRYIVALSCELERRRLGEEDTKRALELSYYFASADLQPMHSIIALRLAINASHKLKNYKSASFLGNKLLQLAESGPAAEAANRAITLGDRNPHDAFEIEYDPHVEMRICPKTLTPVYSGDDFDVCSVCGAVYHKGYVNEVCTVCDVGGIGQKGTGRRFFA | ||||||
Modified residue | 409 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 942 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 9-50 | WD 1 | ||||
Sequence: SRSSRAKGVAFHPTQPWILTSLHNGRIQLWDYRMGTLLDRFD | ||||||
Repeat | 51-90 | WD 2 | ||||
Sequence: GHDGPVRGIAFHPTQPLFVSGGDDYKVNVWNYKSRKLLFS | ||||||
Repeat | 93-134 | WD 3 | ||||
Sequence: GHMDYVRVCTFHHEYPWILSCSDDQTIRIWNWQSRNCIAILT | ||||||
Repeat | 135-174 | WD 4 | ||||
Sequence: GHSHYVMCAAFHPSEDLIVSASLDQTVRVWDISGLRMKNA | ||||||
Repeat | 210-249 | WD 5 | ||||
Sequence: GHDRGVNWCAFHPTLPLILSAGDDRLVKLWRMTASKAWEV | ||||||
Repeat | 254-293 | WD 6 | ||||
Sequence: GHFNNVSCCLFHPHQELILSASEDKTIRVWDLNRRTAVQT | ||||||
Repeat | 296-336 | WD 7 | ||||
Sequence: RDNDRFWFITVHPKLNLFAAAHDSGVMVFKLERERPAHALN | ||||||
Repeat | 370-411 | WD 8 | ||||
Sequence: SAWLPPRSLSYNPAEKVALLTSSADNGVYELVNVSSRSNSLP |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,207
- Mass (Da)136,369
- Last updated2001-12-01 v1
- Checksum4AB701FD7310BE29
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CU329671 EMBL· GenBank· DDBJ | CAC38349.1 EMBL· GenBank· DDBJ | Genomic DNA |