Q96QR1 · SG3A1_HUMAN
- ProteinSecretoglobin family 3A member 1
- GeneSCGB3A1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids104 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Secreted cytokine-like protein. Inhibits cell growth in vitro.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular exosome | |
Cellular Component | extracellular space | |
Molecular Function | cytokine activity | |
Biological Process | negative regulation of cell growth | |
Biological Process | positive regulation of myoblast fusion | |
Biological Process | regulation of cell population proliferation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSecretoglobin family 3A member 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96QR1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 124 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MKLAALLGLCVALSCSSAAA | ||||||
Chain | PRO_0000036383 | 21-104 | Secretoglobin family 3A member 1 | |||
Sequence: FLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG | ||||||
Disulfide bond | 78 | Interchain | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in lung and prostate (PubMed:11481438).
Also found in mammary gland, spleen, pancreas, testis and liver (PubMed:11481438).
Detected throughout the airway epithelium in lung, with highest expression in large airways (PubMed:12406855).
Found in lung submucosal glands where it localizes to acinar and ductile cells (PubMed:12406855).
Not detected in respiratory bronchioles, alveolar ducts or alveolar epithelium (PubMed:12406855).
In mammary gland, specifically localizes to luminal epithelial cells (PubMed:11481438).
Also found in mammary gland, spleen, pancreas, testis and liver (PubMed:11481438).
Detected throughout the airway epithelium in lung, with highest expression in large airways (PubMed:12406855).
Found in lung submucosal glands where it localizes to acinar and ductile cells (PubMed:12406855).
Not detected in respiratory bronchioles, alveolar ducts or alveolar epithelium (PubMed:12406855).
In mammary gland, specifically localizes to luminal epithelial cells (PubMed:11481438).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homodimer; disulfide-linked.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96QR1 | RHBDD2 Q6NTF9-3 | 3 | EBI-9057632, EBI-17589229 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Sequence similarities
Belongs to the secretoglobin family. UGRP subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length104
- Mass (Da)10,100
- Last updated2004-04-13 v2
- ChecksumC1A0951F8FB1455F
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 19 | in Ref. 1; AAK82942 | ||||
Sequence: A → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY040564 EMBL· GenBank· DDBJ | AAK82942.1 EMBL· GenBank· DDBJ | mRNA | ||
AF313458 EMBL· GenBank· DDBJ | AAL26217.1 EMBL· GenBank· DDBJ | mRNA | ||
AF436839 EMBL· GenBank· DDBJ | AAQ04481.1 EMBL· GenBank· DDBJ | mRNA | ||
AY359064 EMBL· GenBank· DDBJ | AAQ89423.1 EMBL· GenBank· DDBJ | mRNA | ||
BC029176 EMBL· GenBank· DDBJ | AAH29176.1 EMBL· GenBank· DDBJ | mRNA | ||
BC072673 EMBL· GenBank· DDBJ | AAH72673.1 EMBL· GenBank· DDBJ | mRNA |