Q96PS8 · AQP10_HUMAN
- ProteinAquaporin-10
- GeneAQP10
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids301 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Isoform 1
Water channel that mediates water transport across cell membranes irrespective of the cytosolic pH (PubMed:12084581, PubMed:21733844, PubMed:23382902, PubMed:30420639).
The channel is permeable to glycerol, especially when the cytosolic pH is acidified (PubMed:21733844, PubMed:30420639).
Contributes to adipocyte water and glycerol permeability, and may thereby contribute to the utilization of glycerol derived from phospholipid degradation (PubMed:23382902).
May contribute to water transport in the intestine (Probable)
The channel is permeable to glycerol, especially when the cytosolic pH is acidified (PubMed:21733844, PubMed:30420639).
Contributes to adipocyte water and glycerol permeability, and may thereby contribute to the utilization of glycerol derived from phospholipid degradation (PubMed:23382902).
May contribute to water transport in the intestine (Probable)
Isoform 2
Water channel that mediates water transport across cell membranes, but that is not permeable to glycerol.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | basolateral plasma membrane | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | lipid droplet | |
Cellular Component | plasma membrane | |
Molecular Function | glycerol channel activity | |
Molecular Function | urea transmembrane transporter activity | |
Molecular Function | water channel activity | |
Biological Process | cellular response to acidic pH | |
Biological Process | glycerol transmembrane transport | |
Biological Process | protein homotetramerization | |
Biological Process | response to toxic substance | |
Biological Process | water transport |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameAquaporin-10
- Short namesAQP-10
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96PS8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Apical cell membrane ; Multi-pass membrane protein
Cell membrane ; Multi-pass membrane protein
Note: Detected around lipid droplets.
Features
Showing features for topological domain, transmembrane, intramembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-25 | Cytoplasmic | ||||
Sequence: MVFTQAPAEIMGHLRIRSLLARQCL | ||||||
Transmembrane | 26-46 | Helical | ||||
Sequence: AEFLGVFVLMLLTQGAVAQAV | ||||||
Topological domain | 47-52 | Extracellular | ||||
Sequence: TSGETK | ||||||
Transmembrane | 53-73 | Helical | ||||
Sequence: GNFFTMFLAGSLAVTIAIYVG | ||||||
Topological domain | 74-77 | Cytoplasmic | ||||
Sequence: GNVS | ||||||
Intramembrane | 78-91 | Discontinuously helical | ||||
Sequence: GAHLNPAFSLAMCI | ||||||
Topological domain | 92-97 | Cytoplasmic | ||||
Sequence: VGRLPW | ||||||
Transmembrane | 98-122 | Helical | ||||
Sequence: VKLPIYILVQLLSAFCASGATYVLY | ||||||
Topological domain | 123-156 | Extracellular | ||||
Sequence: HDALQNYTGGNLTVTGPKETASIFATYPAPYLSL | ||||||
Transmembrane | 157-177 | Helical | ||||
Sequence: NNGFLDQVLGTGMLIVGLLAI | ||||||
Topological domain | 178-187 | Cytoplasmic | ||||
Sequence: LDRRNKGVPA | ||||||
Transmembrane | 188-207 | Helical | ||||
Sequence: GLEPVVVGMLILALGLSMGA | ||||||
Intramembrane | 208-226 | Discontinuously helical | ||||
Sequence: NCGIPLNPARDLGPRLFTY | ||||||
Topological domain | 227-243 | Extracellular | ||||
Sequence: VAGWGPEVFSAGNGWWW | ||||||
Transmembrane | 244-264 | Helical | ||||
Sequence: VPVVAPLVGATVGTATYQLLV | ||||||
Topological domain | 265-301 | Cytoplasmic | ||||
Sequence: ALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_033519 | 15 | in dbSNP:rs6668968 | |||
Sequence: R → Q | ||||||
Mutagenesis | 27 | Abolishes permeability to glycerol. | ||||
Sequence: E → Q | ||||||
Mutagenesis | 73 | Increased permeability to glycerol at acidic pH. | ||||
Sequence: G → A | ||||||
Mutagenesis | 73 | Abolishes permeability to glycerol. | ||||
Sequence: G → F | ||||||
Mutagenesis | 77 | Nearly abolishes permeability to glycerol. | ||||
Sequence: S → A or D | ||||||
Mutagenesis | 80 | Abolishes permeability to glycerol. | ||||
Sequence: H → A | ||||||
Mutagenesis | 85 | Nearly abolishes permeability to glycerol. | ||||
Sequence: F → A | ||||||
Mutagenesis | 94 | Abolishes permeability to glycerol. | ||||
Sequence: R → A | ||||||
Natural variant | VAR_050063 | 123 | in dbSNP:rs6685323 | |||
Sequence: H → Y | ||||||
Mutagenesis | 133 | Abolishes N-glycosylation. | ||||
Sequence: N → Q |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 321 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000063967 | 1-301 | Aquaporin-10 | |||
Sequence: MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL | ||||||
Glycosylation | 128 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 133 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in epithelial cells on villi in the ileum, and also in stomach, jejunum, colon, rectum, white adipose tissue and placenta (at protein level) (PubMed:15221416, PubMed:23382902).
Expressed in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of villi in the jejunum (PubMed:11573934, PubMed:12084581).
Detected in subcutaneous adipose tissue (PubMed:23382902).
Expressed in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of villi in the jejunum (PubMed:11573934, PubMed:12084581).
Detected in subcutaneous adipose tissue (PubMed:23382902).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homotetramer.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 82-84 | NPA 1 | ||||
Sequence: NPA | ||||||
Motif | 214-216 | NPA 2 | ||||
Sequence: NPA |
Domain
Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
Sequence similarities
Belongs to the MIP/aquaporin (TC 1.A.8) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q96PS8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length301
- Mass (Da)31,763
- Last updated2004-05-10 v2
- ChecksumCB2A7AB680548987
Q96PS8-2
- Name2
- Differences from canonical
- 236-301: SAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL → RWETDSPGAGLHSPSSAKGSVPGSTALCL
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_010211 | 236-301 | in isoform 2 | |||
Sequence: SAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL → RWETDSPGAGLHSPSSAKGSVPGSTALCL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF159174 EMBL· GenBank· DDBJ | AAL25998.1 EMBL· GenBank· DDBJ | mRNA | ||
AB066105 EMBL· GenBank· DDBJ | BAB91223.1 EMBL· GenBank· DDBJ | mRNA | ||
AL354980 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC069607 EMBL· GenBank· DDBJ | AAH69607.1 EMBL· GenBank· DDBJ | mRNA | ||
BC074896 EMBL· GenBank· DDBJ | AAH74896.1 EMBL· GenBank· DDBJ | mRNA | ||
BC074897 EMBL· GenBank· DDBJ | AAH74897.1 EMBL· GenBank· DDBJ | mRNA |