Q96NG3 · ODAD4_HUMAN
- ProteinOuter dynein arm-docking complex subunit 4
- GeneODAD4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids672 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the outer dynein arm-docking complex (ODA-DC) that mediates outer dynein arms (ODA) binding onto the doublet microtubule. Plays an essential role for the assembly of ODA-DC and for the docking of ODA in ciliary axoneme.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | 9+0 motile cilium | |
Cellular Component | 9+2 motile cilium | |
Cellular Component | axoneme | |
Cellular Component | cytoplasm | |
Cellular Component | extracellular region | |
Cellular Component | outer dynein arm docking complex | |
Biological Process | brain development | |
Biological Process | cerebrospinal fluid circulation | |
Biological Process | cilium movement | |
Biological Process | epithelial cilium movement involved in determination of left/right asymmetry | |
Biological Process | heart development | |
Biological Process | lung development | |
Biological Process | mucociliary clearance | |
Biological Process | outer dynein arm assembly | |
Biological Process | protein localization to motile cilium |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOuter dynein arm-docking complex subunit 4
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96NG3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Ciliary dyskinesia, primary, 35 (CILD35)
- Note
- DescriptionA form of primary ciliary dyskinesia, a disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia. Some patients exhibit randomization of left-right body asymmetry and situs inversus. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. CILD35 inheritance is autosomal recessive.
- See alsoMIM:617092
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_031758 | 4 | in dbSNP:rs34516580 | |||
Sequence: P → S | ||||||
Natural variant | VAR_031759 | 18 | in dbSNP:rs35516909 | |||
Sequence: A → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 708 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000284507 | 1-672 | UniProt | Outer dynein arm-docking complex subunit 4 | |||
Sequence: MSDPEGETLRSTFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFEFALVFYHRGYKLRPDREFRVGIQKAQEAINNSVGSPSSIKLENKGDLSFLSKQAENIKAQQKPQPMKHLLHPTKGEPKWKASLKSEKTVRQLLGELYVDKEYLEKLLLDEDLIKGTMKGGLTVEDLIMTGINYLDTHSNFWRQQKPIYARERDRKLMQEKWLRDHKRRPSQTAHYILKSLEDIDMLLTSGSAEGSLQKAEKVLKKVLEWNKEEVPNKDELVGNLYSCIGNAQIELGQMEAALQSHRKDLEIAKEYDLPDAKSRALDNIGRVFARVGKFQQAIDTWEEKIPLAKTTLEKTWLFHEIGRCYLELDQAWQAQNYGEKSQQCAEEEGDIEWQLNASVLVAQAQVKLRDFESAVNNFEKALERAKLVHNNEAQQAIISALDDANKGIIRELRKTNYVENLKEKSEGEASLYEDRIITREKDMRRVRDEPEKVVKQWDHSEDEKETDEDDEAFGEALQSPASGKQSVEAGKARSDLGAVAKGLSGELGTRSGETGRKLLEAGRRESREIYRRPSGELEQRLSGEFSRQEPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEYE | |||||||
Modified residue (large scale data) | 624 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the nasal mucosa (at protein level).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of the outer dynein arm-docking complex along with ODAD1, ODAD2 and ODAD3. Interacts with ODAD1; this interaction may facilitate the recruitment and/or attachment of outer dynein arm docking complex proteins, including ODAD1, ODAD3 and ODAD2, to ciliary axonemes (PubMed:27486780).
Interacts with components of the IFT complex A, including IFT140, TTC21B/IFT139 and WDR19/IFT144, and the IFT complex B, including IFT46, IFT52 and IFT57 (PubMed:25860617).
Interacts with CFAP53 (By similarity).
Interacts with components of the IFT complex A, including IFT140, TTC21B/IFT139 and WDR19/IFT144, and the IFT complex B, including IFT46, IFT52 and IFT57 (PubMed:25860617).
Interacts with CFAP53 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96NG3 | CCDC85B Q15834 | 3 | EBI-1046387, EBI-739674 | |
BINARY | Q96NG3 | CEP70 Q8NHQ1 | 3 | EBI-1046387, EBI-739624 | |
BINARY | Q96NG3 | GOLGA2 Q08379 | 3 | EBI-1046387, EBI-618309 | |
BINARY | Q96NG3 | KRT40 Q6A162 | 3 | EBI-1046387, EBI-10171697 | |
BINARY | Q96NG3 | MEOX2 P50222 | 3 | EBI-1046387, EBI-748397 | |
BINARY | Q96NG3 | MKRN3 Q13064 | 3 | EBI-1046387, EBI-2340269 | |
BINARY | Q96NG3 | MYOG P15173 | 3 | EBI-1046387, EBI-3906629 | |
BINARY | Q96NG3 | NECAB2 Q7Z6G3-2 | 3 | EBI-1046387, EBI-10172876 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 13-46 | TPR 1 | ||||
Sequence: FPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGD | ||||||
Repeat | 48-80 | TPR 2 | ||||
Sequence: NCLVARSKCFLKMGDLERSLKDAEASLQSDPAF | ||||||
Repeat | 81-114 | TPR 3 | ||||
Sequence: CKGILQKAETLYTMGDFEFALVFYHRGYKLRPDR | ||||||
Repeat | 275-311 | TPR 4 | ||||
Sequence: LKSLEDIDMLLTSGSAEGSLQKAEKVLKKVLEWNKEE | ||||||
Repeat | 320-353 | TPR 5 | ||||
Sequence: GNLYSCIGNAQIELGQMEAALQSHRKDLEIAKEY | ||||||
Repeat | 360-393 | TPR 6 | ||||
Sequence: SRALDNIGRVFARVGKFQQAIDTWEEKIPLAKTT | ||||||
Repeat | 397-430 | TPR 7 | ||||
Sequence: TWLFHEIGRCYLELDQAWQAQNYGEKSQQCAEEE | ||||||
Repeat | 437-470 | TPR 8 | ||||
Sequence: LNASVLVAQAQVKLRDFESAVNNFEKALERAKLV | ||||||
Compositional bias | 527-544 | Basic and acidic residues | ||||
Sequence: RVRDEPEKVVKQWDHSED | ||||||
Region | 527-672 | Disordered | ||||
Sequence: RVRDEPEKVVKQWDHSEDEKETDEDDEAFGEALQSPASGKQSVEAGKARSDLGAVAKGLSGELGTRSGETGRKLLEAGRRESREIYRRPSGELEQRLSGEFSRQEPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEYE | ||||||
Compositional bias | 598-672 | Basic and acidic residues | ||||
Sequence: RKLLEAGRRESREIYRRPSGELEQRLSGEFSRQEPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEYE |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q96NG3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length672
- Mass (Da)76,655
- Last updated2007-04-17 v2
- Checksum15683F576C1DAC35
Q96NG3-2
- Name2
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087X2G9 | A0A087X2G9_HUMAN | ODAD4 | 85 | ||
A0A087WTJ8 | A0A087WTJ8_HUMAN | ODAD4 | 382 | ||
A0A087WVI5 | A0A087WVI5_HUMAN | ODAD4 | 20 |
Sequence caution
Features
Showing features for sequence conflict, alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 43 | in Ref. 3; AAH25390 | ||||
Sequence: Q → K | ||||||
Alternative sequence | VSP_024548 | 209-292 | in isoform 2 | |||
Sequence: DLIKGTMKGGLTVEDLIMTGINYLDTHSNFWRQQKPIYARERDRKLMQEKWLRDHKRRPSQTAHYILKSLEDIDMLLTSGSAEG → VTFLMQNREPLTTLAEFLPELGNSSKPLTRGKKRSLWQKPPWRRPGCSTRSAAATWSWTRPGRPRIMARSPSSVPRRKGTLSGN | ||||||
Sequence conflict | 244 | in Ref. 2; BAB70936 | ||||
Sequence: P → L | ||||||
Alternative sequence | VSP_024549 | 293-672 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 527-544 | Basic and acidic residues | ||||
Sequence: RVRDEPEKVVKQWDHSED | ||||||
Compositional bias | 598-672 | Basic and acidic residues | ||||
Sequence: RKLLEAGRRESREIYRRPSGELEQRLSGEFSRQEPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEYE |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL136760 EMBL· GenBank· DDBJ | CAB66694.1 EMBL· GenBank· DDBJ | mRNA | ||
AK055498 EMBL· GenBank· DDBJ | BAB70936.1 EMBL· GenBank· DDBJ | mRNA | ||
BC025390 EMBL· GenBank· DDBJ | AAH25390.1 EMBL· GenBank· DDBJ | mRNA | ||
BC067297 EMBL· GenBank· DDBJ | AAH67297.1 EMBL· GenBank· DDBJ | mRNA | Frameshift |