Q96HW7 · INT4_HUMAN
- ProteinIntegrator complex subunit 4
- GeneINTS4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids963 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes (Probable). Mediates recruitment of cytoplasmic dynein to the nuclear envelope, probably as component of the INT complex (PubMed:23904267).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | integrator complex | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Biological Process | regulation of transcription elongation by RNA polymerase II | |
Biological Process | snRNA processing |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameIntegrator complex subunit 4
- Short namesInt4
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96HW7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 951 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data), cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000259538 | 1-963 | UniProt | Integrator complex subunit 4 | |||
Sequence: MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQNEKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSLEKSVTKDAEGLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKLLSDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRVQAAKLLGSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPKEEVDTGAVNLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMFNDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKEGIHLALVELLKNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMDDPAYIAVLVLIFNAAKTCPTMPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVSPSIIPQEDPSQQFLQQSLERVYSLQHLDPQGAQELLEFTIRDLQRLGELQSELAGVADFSATYLRCQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQIMEETYKMEFMYSGVENKQVVIIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLPHLQDSFVDKLLDLMPRLMTSKPAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSGLVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSHTAWTEACQVEVRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKPARR | |||||||
Modified residue | 26 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 345 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 600 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 602 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 791 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternate | ||||
Sequence: K | |||||||
Cross-link | 791 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Belongs to the multiprotein complex Integrator, at least composed of INTS1, INTS2, INTS3, INTS4, INTS5, INTS6, INTS7, INTS8, INTS9/RC74, INTS10, INTS11/CPSF3L and INTS12.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96HW7 | HGS O14964 | 4 | EBI-5663129, EBI-740220 | |
BINARY | Q96HW7 | INTS9 Q9NV88 | 5 | EBI-5663129, EBI-2866634 | |
BINARY | Q96HW7 | USHBP1 Q8N6Y0 | 3 | EBI-5663129, EBI-739895 | |
BINARY | Q96HW7 | ZMIZ2 Q8NF64-2 | 3 | EBI-5663129, EBI-10182121 | |
BINARY | Q96HW7-2 | HGS O14964 | 3 | EBI-16438029, EBI-740220 | |
BINARY | Q96HW7-3 | LHX3 Q9UBR4-2 | 3 | EBI-12240836, EBI-12039345 | |
BINARY | Q96HW7-3 | MEIS3 Q99687-3 | 3 | EBI-12240836, EBI-18582591 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 66-105 | HEAT 1 | ||||
Sequence: AESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGF | ||||||
Repeat | 145-183 | HEAT 2 | ||||
Sequence: QAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSLEKS | ||||||
Repeat | 190-228 | HEAT 3 | ||||
Sequence: GLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLK | ||||||
Repeat | 229-263 | HEAT 4 | ||||
Sequence: LHQTIYNQACKLLSDDYEQVRSAAVQLIWVVSQLY | ||||||
Repeat | 277-313 | HEAT 5 | ||||
Sequence: IRLVDDAFGKICHMVSDGSWVVRVQAAKLLGSMEQVS | ||||||
Repeat | 369-405 | HEAT 6 | ||||
Sequence: NLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSS | ||||||
Repeat | 406-444 | HEAT 7 | ||||
Sequence: PSFAEKCLDFLVDMFNDEIEEVRLQSIHTMRKISNNITL | ||||||
Repeat | 446-484 | HEAT 8 | ||||
Sequence: EDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKEGIHL |
Sequence similarities
Belongs to the Integrator subunit 4 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q96HW7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length963
- Mass (Da)108,171
- Last updated2006-10-31 v2
- ChecksumD56D6480EFC962D7
Q96HW7-2
- Name2
- Differences from canonical
- 506-963: Missing
Q96HW7-3
- Name3
- NoteMay be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Computationally mapped potential isoform sequences
There are 18 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F8WAA7 | F8WAA7_HUMAN | INTS4 | 132 | ||
E9PIM3 | E9PIM3_HUMAN | INTS4 | 96 | ||
A0A8V8TLR7 | A0A8V8TLR7_HUMAN | INTS4 | 963 | ||
A0A8C8UVZ7 | A0A8C8UVZ7_HUMAN | INTS4 | 654 | ||
A0A8Q3WKC2 | A0A8Q3WKC2_HUMAN | INTS4 | 418 | ||
A0A8Q3WKC7 | A0A8Q3WKC7_HUMAN | INTS4 | 931 | ||
A0A8Q3WKC9 | A0A8Q3WKC9_HUMAN | INTS4 | 953 | ||
A0A8Q3WKC3 | A0A8Q3WKC3_HUMAN | INTS4 | 943 | ||
A0A8Q3WKB5 | A0A8Q3WKB5_HUMAN | INTS4 | 511 | ||
A0A8Q3WKB9 | A0A8Q3WKB9_HUMAN | INTS4 | 936 | ||
A0A8Q3WKW5 | A0A8Q3WKW5_HUMAN | INTS4 | 548 | ||
A0A8Q3SII1 | A0A8Q3SII1_HUMAN | INTS4 | 1013 | ||
A0A8Q3SHR8 | A0A8Q3SHR8_HUMAN | INTS4 | 757 | ||
A0A8Q3SHT4 | A0A8Q3SHT4_HUMAN | INTS4 | 658 | ||
A0A8Q3SHU3 | A0A8Q3SHU3_HUMAN | INTS4 | 853 | ||
A0A8Q3SHK8 | A0A8Q3SHK8_HUMAN | INTS4 | 357 | ||
A0A8Q3SHL8 | A0A8Q3SHL8_HUMAN | INTS4 | 910 | ||
A0A8Q3SHM4 | A0A8Q3SHM4_HUMAN | INTS4 | 852 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_021448 | 1-148 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_021449 | 149-156 | in isoform 3 | |||
Sequence: MRLVDVAC → MPSTSCRM | ||||||
Alternative sequence | VSP_021450 | 506-963 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_021452 | 642-659 | in isoform 3 | |||
Sequence: DLQRLGELQSELAGVADF → VEVSPWWPGWSQTPELK | ||||||
Alternative sequence | VSP_021453 | 660-963 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 900-901 | in Ref. 2; AAQ13616 | ||||
Sequence: HT → PP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC006369 EMBL· GenBank· DDBJ | AAH06369.1 EMBL· GenBank· DDBJ | mRNA | ||
BC008013 EMBL· GenBank· DDBJ | AAH08013.1 EMBL· GenBank· DDBJ | mRNA | ||
BC009859 EMBL· GenBank· DDBJ | AAH09859.2 EMBL· GenBank· DDBJ | mRNA | ||
BC009995 EMBL· GenBank· DDBJ | AAH09995.1 EMBL· GenBank· DDBJ | mRNA | ||
BC015664 EMBL· GenBank· DDBJ | AAH15664.1 EMBL· GenBank· DDBJ | mRNA | ||
AF172822 EMBL· GenBank· DDBJ | AAQ13616.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BK005723 EMBL· GenBank· DDBJ | DAA05723.1 EMBL· GenBank· DDBJ | mRNA |