Q96GX8 · CP074_HUMAN
- ProteinUncharacterized protein C16orf74
- GeneC16orf74
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
Miscellaneous
May act as a prognostic marker of median survival time in pancreatic cancer patients.
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUncharacterized protein C16orf74
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96GX8
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 36-41 | Abolishes interaction with PPP3CA. | ||||
Sequence: Missing | ||||||
Mutagenesis | 41 | No effect on phosphorylation. | ||||
Sequence: T → A | ||||||
Mutagenesis | 44 | Abolished phosphorylation and interaction with PPP3CA. | ||||
Sequence: T → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 120 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000264621 | 1-76 | UniProt | Uncharacterized protein C16orf74 | |||
Sequence: MGLKMSCLKGFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDPEA | |||||||
Modified residue (large scale data) | 19 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 20 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 41 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 44 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 44 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 46 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 46 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Isoform 1
Not expressed in pancreatic duct cells (at protein level). Abundantly expressed in the pancreas and weakly expressed in the thyroid.
Isoform 2
Not expressed in pancreatic duct cells (at protein level). Abundantly expressed in the lymph node and weakly expressed in the stomach, trachea and bone marrow.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts (via PxIxIT motif, when phosphorylated on Thr-44) with PPP3CA.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96GX8 | PPP3CA Q08209 | 4 | EBI-745814, EBI-352922 | |
BINARY | Q96GX8 | PPP3CA Q08209-2 | 3 | EBI-745814, EBI-11959013 | |
BINARY | Q96GX8 | UNC119 Q13432 | 7 | EBI-745814, EBI-711260 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q96GX8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsV1
- Length76
- Mass (Da)8,118
- Last updated2011-04-05 v2
- Checksum525DD517D5EA9F12
Q96GX8-2
- Name2
- SynonymsV3
- Differences from canonical
- 1-12: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_061477 | 1-12 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC123908 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC018695 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AB115766 EMBL· GenBank· DDBJ | BAS02098.1 EMBL· GenBank· DDBJ | mRNA | ||
BC009078 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
BQ672221 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |