Q96GW7 · PGCB_HUMAN
- ProteinBrevican core protein
- GeneBCAN
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids911 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Cellular Component | glutamatergic synapse | |
Cellular Component | Golgi lumen | |
Cellular Component | lysosomal lumen | |
Cellular Component | perineuronal net | |
Cellular Component | side of membrane | |
Cellular Component | synapse | |
Molecular Function | carbohydrate binding | |
Molecular Function | hyaluronic acid binding | |
Biological Process | cell adhesion | |
Biological Process | central nervous system development | |
Biological Process | glial cell differentiation | |
Biological Process | hippocampus development | |
Biological Process | positive regulation of neuroblast proliferation | |
Biological Process | skeletal system development | |
Biological Process | synapse maturation |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBrevican core protein
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96GW7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_050123 | 356 | in dbSNP:rs12065791 | |||
Sequence: S → L | ||||||
Natural variant | VAR_019551 | 504 | in dbSNP:rs1056695 | |||
Sequence: E → K |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,128 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, modified residue, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MAQLFLPLLAALVLAQAPAALA | ||||||
Chain | PRO_0000017511 | 23-911 | Brevican core protein | |||
Sequence: DVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPSAIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESESRGAIYSIPIMEDGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALWAWPSELSSPGPEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPTETLPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRAPEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGGTCLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLRYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPEEDPEGRQGRLLGRWKALLIPPSSPMPGP | ||||||
Disulfide bond | 57↔137 | |||||
Sequence: CHVHYLRPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRC | ||||||
Glycosylation | 130 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 179↔250 | |||||
Sequence: CARIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYC | ||||||
Disulfide bond | 203↔224 | |||||
Sequence: CDAGWLSDQTVRYPIQTPREAC | ||||||
Disulfide bond | 277↔352 | |||||
Sequence: CQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYC | ||||||
Disulfide bond | 301↔322 | |||||
Sequence: CSPGWLADGSVRYPIVTPSQRC | ||||||
Glycosylation | 337 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 418 | Phosphoserine | ||||
Sequence: S | ||||||
Glycosylation | 418 | O-linked (Xyl...) (chondroitin sulfate) serine | ||||
Sequence: S | ||||||
Lipidation | 646 | In isoform Q96GW7-2; GPI-anchor amidated alanine | ||||
Sequence: A | ||||||
Disulfide bond | 650↔661 | |||||
Sequence: CVPSPCHNGGTC | ||||||
Disulfide bond | 655↔670 | |||||
Sequence: CHNGGTCLEEEEGVRC | ||||||
Disulfide bond | 672↔681 | |||||
Sequence: CLPGYGGDLC | ||||||
Disulfide bond | 688↔699 | |||||
Sequence: CNPGWDAFQGAC | ||||||
Disulfide bond | 716↔808 | |||||
Sequence: CRMYGAHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTC | ||||||
Disulfide bond | 784↔800 | |||||
Sequence: CVVMVWHDQGQWSDVPC | ||||||
Disulfide bond | 815↔858 | |||||
Sequence: CGPPPELPLAQVFGRPRLRYEVDTVLRYRCREGLAQRNLPLIRC | ||||||
Disulfide bond | 844↔871 | |||||
Sequence: CREGLAQRNLPLIRCQENGRWEAPQISC | ||||||
Glycosylation | 905 | O-linked (GalNAc...) serine | ||||
Sequence: S | ||||||
Glycosylation | 906 | O-linked (GalNAc...) serine | ||||
Sequence: S |
Post-translational modification
O-glycosylated; contains chondroitin sulfate (PubMed:25326458).
O-glycosylated with a core 1 or possibly core 8 glycan (PubMed:19838169).
O-glycosylated with a core 1 or possibly core 8 glycan (PubMed:19838169).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the retina, specifically in the inner nuclear layer, inner plexiform layer and ganglion cell layer (at protein level) (PubMed:29777959).
Detected in cerebrospinal fluid (at protein level) (PubMed:25326458).
Detected in urine (at protein level) (PubMed:37453717).
Detected in cerebrospinal fluid (at protein level) (PubMed:25326458).
Detected in urine (at protein level) (PubMed:37453717).
Developmental stage
Expressed between 6 and 19 weeks post-conception (WPC) in the outer neuroblastic zone, inner neuroblastic zone, and inner plexiform layer of the retina (at protein level) (PubMed:29777959).
Expressed at the surface ectoderm at 6 WPC and the neural retinal at 6 to 8 WPC (at protein level) (PubMed:29777959).
Expressed in the interphotoreceptor matrix and abundantly in developing photoreceptors between 12 and 19 WPC (at protein level) (PubMed:29777959).
Isoform 1: Highly expressed from birth through 8 years of age and is down-regulated by 20 years of age to low levels that are maintained in the normal adult cortex (PubMed:11054543).
Isoform 2: Expressed at uniformly low levels throughout development (PubMed:11054543).
Expressed at the surface ectoderm at 6 WPC and the neural retinal at 6 to 8 WPC (at protein level) (PubMed:29777959).
Expressed in the interphotoreceptor matrix and abundantly in developing photoreceptors between 12 and 19 WPC (at protein level) (PubMed:29777959).
Isoform 1: Highly expressed from birth through 8 years of age and is down-regulated by 20 years of age to low levels that are maintained in the normal adult cortex (PubMed:11054543).
Isoform 2: Expressed at uniformly low levels throughout development (PubMed:11054543).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with TNR.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96GW7 | APLP2 Q06481-5 | 3 | EBI-2690445, EBI-25646567 | |
BINARY | Q96GW7 | APP P05067 | 3 | EBI-2690445, EBI-77613 | |
BINARY | Q96GW7 | CSNK1D P48730-2 | 3 | EBI-2690445, EBI-9087876 | |
BINARY | Q96GW7 | LYN P07948 | 3 | EBI-2690445, EBI-79452 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 36-155 | Ig-like V-type | ||||
Sequence: RVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVK | ||||||
Domain | 157-252 | Link 1 | ||||
Sequence: VVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCYA | ||||||
Domain | 257-354 | Link 2 | ||||
Sequence: GELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR | ||||||
Region | 391-641 | Disordered | ||||
Sequence: QLPQEATESESRGAIYSIPIMEDGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALWAWPSELSSPGPEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPTETLPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRAPEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGV | ||||||
Compositional bias | 453-479 | Acidic residues | ||||
Sequence: LEEEEKYEDEEEKEEEEEEEEVEDEAL | ||||||
Region | 520-530 | O-glycosylated at two sites | ||||
Sequence: SPLPDGESEAS | ||||||
Region | 540-545 | O-glycosylated at two sites | ||||
Sequence: TETLPT | ||||||
Region | 569-575 | O-glycosylated at one site | ||||
Sequence: TGGPELS | ||||||
Compositional bias | 616-633 | Polar residues | ||||
Sequence: GRTAPAGTSVQAQPVLPT | ||||||
Domain | 646-682 | EGF-like | ||||
Sequence: ASGDCVPSPCHNGGTCLEEEEGVRCLCLPGYGGDLCD | ||||||
Domain | 695-809 | C-type lectin | ||||
Sequence: FQGACYKHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCK | ||||||
Domain | 813-873 | Sushi | ||||
Sequence: VSCGPPPELPLAQVFGRPRLRYEVDTVLRYRCREGLAQRNLPLIRCQENGRWEAPQISCVP |
Sequence similarities
Belongs to the aggrecan/versican proteoglycan family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q96GW7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length911
- Mass (Da)99,118
- Last updated2005-06-21 v2
- Checksum5268E796FA3938D2
Q96GW7-2
- Name2
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 175 | in Ref. 5; AAH22938 | ||||
Sequence: A → T | ||||||
Compositional bias | 453-479 | Acidic residues | ||||
Sequence: LEEEEKYEDEEEKEEEEEEEEVEDEAL | ||||||
Compositional bias | 616-633 | Polar residues | ||||
Sequence: GRTAPAGTSVQAQPVLPT | ||||||
Alternative sequence | VSP_011184 | 649-671 | in isoform 2 | |||
Sequence: DCVPSPCHNGGTCLEEEEGVRCL → NSAQGSTALSILLLFFPLQLWVT | ||||||
Alternative sequence | VSP_011185 | 672-911 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF228710 EMBL· GenBank· DDBJ | AAG23134.1 EMBL· GenBank· DDBJ | mRNA | ||
AF229053 EMBL· GenBank· DDBJ | AAG23135.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358372 EMBL· GenBank· DDBJ | AAQ88738.1 EMBL· GenBank· DDBJ | mRNA | ||
AL365181 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL590666 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471121 EMBL· GenBank· DDBJ | EAW52927.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471121 EMBL· GenBank· DDBJ | EAW52928.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471121 EMBL· GenBank· DDBJ | EAW52929.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471121 EMBL· GenBank· DDBJ | EAW52930.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC009117 EMBL· GenBank· DDBJ | AAH09117.1 EMBL· GenBank· DDBJ | mRNA | ||
BC022938 EMBL· GenBank· DDBJ | AAH22938.1 EMBL· GenBank· DDBJ | mRNA | ||
BC027971 EMBL· GenBank· DDBJ | AAH27971.1 EMBL· GenBank· DDBJ | mRNA |