Q96GJ1 · TRM2B_HUMAN
- ProteintRNA (uracil-5-)-methyltransferase homolog B
- GeneTRMT2B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids504 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Mitochondrial S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the formation of 5-methyl-uridine in tRNAs and 12S rRNA (PubMed:31948311, PubMed:34556860).
Catalyzes the methylation of uridine at position 54 (m5U54) in all tRNAs (PubMed:31948311).
Specifically methylates the uridine in position 429 of 12S rRNA (m5U429) (PubMed:31948311).
Does not affect RNA stability or mitochondrial translation (PubMed:31948311).
Catalyzes the methylation of uridine at position 54 (m5U54) in all tRNAs (PubMed:31948311).
Specifically methylates the uridine in position 429 of 12S rRNA (m5U429) (PubMed:31948311).
Does not affect RNA stability or mitochondrial translation (PubMed:31948311).
Catalytic activity
- S-adenosyl-L-methionine + uridine54 in tRNA = 5-methyluridine54 in tRNA + H+ + S-adenosyl-L-homocysteineThis reaction proceeds in the forward direction.
- a uridine in 12S rRNA + S-adenosyl-L-methionine = a 5-methyluridine in 12S rRNA + H+ + S-adenosyl-L-homocysteineThis reaction proceeds in the forward direction.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 323 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 373 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 423 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Active site | 451 | Nucleophile | ||||
Sequence: C | ||||||
Active site | 497 | Proton acceptor | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Molecular Function | rRNA (uridine-C5-)-methyltransferase activity | |
Molecular Function | tRNA (uracil(54)-C5)-methyltransferase activity, S-adenosyl methionine-dependent | |
Biological Process | tRNA processing |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nametRNA (uracil-5-)-methyltransferase homolog B
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96GJ1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Isoform 1
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_037355 | 12 | in dbSNP:rs7064613 | |||
Sequence: S → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 441 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-16 | Mitochondrion | ||||
Sequence: MAGLKRRVPLHSLRYF | ||||||
Chain | PRO_0000311932 | 17-504 | tRNA (uracil-5-)-methyltransferase homolog B | |||
Sequence: ISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKLSQEELHVQKEIVKEFFIRGPGAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDAFFQINTAGAEMLYRTVGELTGVNSDTILLDICCGTGVIGLSLAQHTSRVLGIELLEQAVEDARWTAAFNGITNSEFHTGQAEKILPGLLKSKEDGQSIVAVVNPARAGLHYKVIQAIRNFRAIHTLVFVSCKLHGESTRNVIELCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVLLFTR |
Proteomic databases
PTM databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96GJ1 | ERCC1 P07992 | 3 | EBI-10195625, EBI-750962 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
Q96GJ1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length504
- Mass (Da)56,476
- Last updated2001-12-01 v1
- ChecksumD7A28E168AC9C366
Q96GJ1-2
- Name2
- Differences from canonical
- 464-504: LCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVLLFTR → RSLILLECSGMVSAHCSLHLPGSSDSPASAS
Q96GJ1-3
- Name3
- Differences from canonical
- 102-146: Missing
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_029643 | 102-146 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 238 | in Ref. 1; BAB14223 | ||||
Sequence: H → R | ||||||
Sequence conflict | 451 | in Ref. 2; CAI46112 | ||||
Sequence: C → R | ||||||
Alternative sequence | VSP_029644 | 464-504 | in isoform 2 | |||
Sequence: LCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVLLFTR → RSLILLECSGMVSAHCSLHLPGSSDSPASAS |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK022749 EMBL· GenBank· DDBJ | BAB14223.1 EMBL· GenBank· DDBJ | mRNA | ||
AL832849 EMBL· GenBank· DDBJ | CAI46112.1 EMBL· GenBank· DDBJ | mRNA | ||
AL109952 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL133275 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
Z97985 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471115 EMBL· GenBank· DDBJ | EAX02831.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471115 EMBL· GenBank· DDBJ | EAX02837.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC007526 EMBL· GenBank· DDBJ | AAH07526.1 EMBL· GenBank· DDBJ | mRNA | ||
BC008067 EMBL· GenBank· DDBJ | AAH08067.2 EMBL· GenBank· DDBJ | mRNA | ||
BC009437 EMBL· GenBank· DDBJ | AAH09437.1 EMBL· GenBank· DDBJ | mRNA | ||
BC020116 EMBL· GenBank· DDBJ | AAH20116.1 EMBL· GenBank· DDBJ | mRNA | ||
BC034272 EMBL· GenBank· DDBJ | AAH34272.1 EMBL· GenBank· DDBJ | mRNA |