Q96EW2 · HBAP1_HUMAN
- ProteinHSPB1-associated protein 1
- GeneHSPBAP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids488 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May play a role in cellular stress response.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | 2-oxoglutarate-dependent dioxygenase activity |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHSPB1-associated protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96EW2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_031703 | 64 | in dbSNP:rs16833517 | |||
Sequence: S → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 467 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000284113 | 1-488 | UniProt | HSPB1-associated protein 1 | |||
Sequence: MAAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVFDWPARHWNAKYLSQVLHGKQIRFRMGMKSMSTVPQFETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYKYFVSLFEDKTDLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKRFPQFRKAQRHAVTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIELEEDHLARVEEAITRMLVCALKTAENPQNTRAWLNPTEVEETSHAVNCCYLNAAVSAFFDRCRTSEVVEIQALRTDGEHMKKEELNVCNHMEVGQTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFISTDDLLDCLVNPQVTRIVAQLLIQGRSL | |||||||
Modified residue (large scale data) | 8 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 9 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with CRYAB and HSPB1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96EW2 | ABHD10 Q9NUJ1 | 2 | EBI-720457, EBI-2564608 | |
BINARY | Q96EW2 | ARHGEF5 Q12774 | 6 | EBI-720457, EBI-602199 | |
BINARY | Q96EW2 | NCALD P61601 | 2 | EBI-720457, EBI-749635 | |
BINARY | Q96EW2 | NUTM1 Q86Y26 | 3 | EBI-720457, EBI-10178410 | |
BINARY | Q96EW2 | SDE2 Q6IQ49 | 2 | EBI-720457, EBI-2362709 | |
BINARY | Q96EW2-2 | CASP6 P55212 | 3 | EBI-25835621, EBI-718729 | |
BINARY | Q96EW2-2 | FGFR3 P22607 | 3 | EBI-25835621, EBI-348399 | |
BINARY | Q96EW2-2 | GSN P06396 | 3 | EBI-25835621, EBI-351506 | |
BINARY | Q96EW2-2 | HIP1 O00291 | 3 | EBI-25835621, EBI-473886 | |
BINARY | Q96EW2-2 | HSPB1 P04792 | 3 | EBI-25835621, EBI-352682 | |
BINARY | Q96EW2-2 | KIF1B O60333-2 | 3 | EBI-25835621, EBI-10975473 | |
BINARY | Q96EW2-2 | LAMP2 P13473-2 | 3 | EBI-25835621, EBI-21591415 | |
BINARY | Q96EW2-2 | PRPF40A O75400-2 | 3 | EBI-25835621, EBI-5280197 | |
BINARY | Q96EW2-2 | WFS1 O76024 | 3 | EBI-25835621, EBI-720609 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 88-208 | Interaction with HSPB1 | ||||
Sequence: ETTCNYVEATLEEFLTWNCDQSSISGPFRDYDHSKFWAYADYKYFVSLFEDKTDLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTR | ||||||
Domain | 124-288 | JmjC | ||||
Sequence: WAYADYKYFVSLFEDKTDLFQDVKWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKRFPQFRKAQRHAVTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIELEEDHLARVEEAIT | ||||||
Region | 369-415 | Disordered | ||||
Sequence: QTGSQNLTTGTDKPEAASPFGPDLVPVAQRSEEPPSERGGIFGSDGK |
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q96EW2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length488
- Mass (Da)55,167
- Last updated2001-12-01 v1
- Checksum504621FC6762F796
Q96EW2-2
- Name2
Q96EW2-3
- Name3
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 46 | in Ref. 2; BAC04847 | ||||
Sequence: F → L | ||||||
Alternative sequence | VSP_024442 | 191-225 | in isoform 2 | |||
Sequence: KRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNP → LECNGMIIAPGPQAILLPQPLKYLGLQETMASLSS | ||||||
Alternative sequence | VSP_024443 | 226-488 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_024444 | 250-280 | in isoform 3 | |||
Sequence: FVPRHWWHYVESIDPVTVSINSWIELEEDHL → ERKWQEGTQLLLLVKRRMDFGGRQSTRVIFI | ||||||
Alternative sequence | VSP_024445 | 281-488 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 320 | in Ref. 1; AAM64044 | ||||
Sequence: V → A | ||||||
Sequence conflict | 456 | in Ref. 3; AAH17763 | ||||
Sequence: P → PS |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF400663 EMBL· GenBank· DDBJ | AAM64044.1 EMBL· GenBank· DDBJ | mRNA | ||
AK096705 EMBL· GenBank· DDBJ | BAC04847.1 EMBL· GenBank· DDBJ | mRNA | ||
BC011897 EMBL· GenBank· DDBJ | AAH11897.1 EMBL· GenBank· DDBJ | mRNA | ||
BC017763 EMBL· GenBank· DDBJ | AAH17763.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BC063629 EMBL· GenBank· DDBJ | AAH63629.1 EMBL· GenBank· DDBJ | mRNA |