Q96EE3 · SEH1_HUMAN
- ProteinNucleoporin SEH1
- GeneSEH1L
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids360 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC (PubMed:15146057, PubMed:17363900).
The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation. This subunit plays a role in recruitment of the Nup107-160 subcomplex to the kinetochore (PubMed:15146057, PubMed:17363900).
The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation. This subunit plays a role in recruitment of the Nup107-160 subcomplex to the kinetochore (PubMed:15146057, PubMed:17363900).
As a component of the GATOR2 complex, functions as an activator of the amino acid-sensing branch of the mTORC1 signaling pathway (PubMed:23723238, PubMed:25457612, PubMed:27487210, PubMed:35831510, PubMed:36528027).
The GATOR2 complex indirectly activates mTORC1 through the inhibition of the GATOR1 subcomplex (PubMed:23723238, PubMed:27487210, PubMed:35831510, PubMed:36528027).
GATOR2 probably acts as an E3 ubiquitin-protein ligase toward GATOR1 (PubMed:36528027).
In the presence of abundant amino acids, the GATOR2 complex mediates ubiquitination of the NPRL2 core component of the GATOR1 complex, leading to GATOR1 inactivation (PubMed:36528027).
In the absence of amino acids, GATOR2 is inhibited, activating the GATOR1 complex (PubMed:25457612, PubMed:26972053, PubMed:27487210).
Within the GATOR2 complex, SEC13 and SEH1L are required to stabilize the complex (PubMed:35831510).
The GATOR2 complex indirectly activates mTORC1 through the inhibition of the GATOR1 subcomplex (PubMed:23723238, PubMed:27487210, PubMed:35831510, PubMed:36528027).
GATOR2 probably acts as an E3 ubiquitin-protein ligase toward GATOR1 (PubMed:36528027).
In the presence of abundant amino acids, the GATOR2 complex mediates ubiquitination of the NPRL2 core component of the GATOR1 complex, leading to GATOR1 inactivation (PubMed:36528027).
In the absence of amino acids, GATOR2 is inhibited, activating the GATOR1 complex (PubMed:25457612, PubMed:26972053, PubMed:27487210).
Within the GATOR2 complex, SEC13 and SEH1L are required to stabilize the complex (PubMed:35831510).
Activity regulation
The GATOR2 complex is negatively regulated by the upstream amino acid sensors CASTOR1 and SESN2, which sequester the GATOR2 complex in absence of amino acids (PubMed:25457612, PubMed:26972053, PubMed:27487210, PubMed:35831510).
In the presence of abundant amino acids, GATOR2 is released from CASTOR1 and SESN2 and activated (PubMed:25457612, PubMed:26972053, PubMed:27487210, PubMed:35831510).
In the presence of abundant amino acids, GATOR2 is released from CASTOR1 and SESN2 and activated (PubMed:25457612, PubMed:26972053, PubMed:27487210, PubMed:35831510).
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | GATOR2 complex | |
Cellular Component | kinetochore | |
Cellular Component | lysosomal membrane | |
Cellular Component | nuclear envelope | |
Cellular Component | nuclear pore | |
Cellular Component | nuclear pore outer ring | |
Cellular Component | Seh1-associated complex | |
Molecular Function | structural molecule activity | |
Biological Process | attachment of mitotic spindle microtubules to kinetochore | |
Biological Process | cell division | |
Biological Process | cellular response to amino acid starvation | |
Biological Process | cellular response to nutrient levels | |
Biological Process | defense response to Gram-positive bacterium | |
Biological Process | mitotic metaphase chromosome alignment | |
Biological Process | mRNA transport | |
Biological Process | negative regulation of TORC1 signaling | |
Biological Process | nuclear pore organization | |
Biological Process | nucleocytoplasmic transport | |
Biological Process | positive regulation of TORC1 signaling | |
Biological Process | protein transport | |
Biological Process | protein-containing complex localization |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameNucleoporin SEH1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96EE3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_053417 | 342 | in dbSNP:rs6505776 | |||
Sequence: T → N |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 351 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, cross-link, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000051213 | 1-360 | UniProt | Nucleoporin SEH1 | |||
Sequence: MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS | |||||||
Cross-link | 12 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 179 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 179 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 189 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 190 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 190 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 259 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 260 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 365 | UniProt | In isoform Q96EE3-1; Phosphoserine |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC) (PubMed:17360435).
The Nup107-160 subcomplex includes NUP160, NUP133, NUP107, NUP98, NUP85, NUP43, NUP37, SEH1 and SEC13 (PubMed:17360435).
The SEH1 subunit appears to be only weakly associated with the Nup107-160 subcomplex (PubMed:17360435).
Component of the GATOR2 subcomplex, composed of MIOS, SEC13, SEH1L, WDR24 and WDR59 (PubMed:23723238).
The GATOR2 complex interacts with CASTOR1 and CASTOR2; the interaction is negatively regulated by arginine (PubMed:26972053, PubMed:35831510, PubMed:36528027).
The GATOR2 complex interacts with SESN1, SESN2 and SESN3; the interaction is negatively regulated by amino acids (PubMed:25263562, PubMed:25457612).
SESN1, SESN2 and SESN3 convey leucine availability via direct interaction with SEH1L and WDR24 (PubMed:35831510).
The Nup107-160 subcomplex includes NUP160, NUP133, NUP107, NUP98, NUP85, NUP43, NUP37, SEH1 and SEC13 (PubMed:17360435).
The SEH1 subunit appears to be only weakly associated with the Nup107-160 subcomplex (PubMed:17360435).
Component of the GATOR2 subcomplex, composed of MIOS, SEC13, SEH1L, WDR24 and WDR59 (PubMed:23723238).
The GATOR2 complex interacts with CASTOR1 and CASTOR2; the interaction is negatively regulated by arginine (PubMed:26972053, PubMed:35831510, PubMed:36528027).
The GATOR2 complex interacts with SESN1, SESN2 and SESN3; the interaction is negatively regulated by amino acids (PubMed:25263562, PubMed:25457612).
SESN1, SESN2 and SESN3 convey leucine availability via direct interaction with SEH1L and WDR24 (PubMed:35831510).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96EE3 | NUP85 Q9BW27 | 3 | EBI-922818, EBI-716392 | |
BINARY | Q96EE3 | SEC13 P55735 | 8 | EBI-922818, EBI-1046596 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 10-49 | WD 1 | ||||
Sequence: DHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHC | ||||||
Repeat | 55-96 | WD 2 | ||||
Sequence: THSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDK | ||||||
Repeat | 111-152 | WD 3 | ||||
Sequence: DSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQ | ||||||
Repeat | 160-210 | WD 4 | ||||
Sequence: SCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYA | ||||||
Repeat | 217-258 | WD 5 | ||||
Sequence: TVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELT | ||||||
Repeat | 276-315 | WD 6 | ||||
Sequence: NHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKC | ||||||
Region | 324-360 | Disordered | ||||
Sequence: SPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS |
Sequence similarities
Belongs to the WD repeat SEC13 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q96EE3-2
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameA
- SynonymsSEH1A
- Length360
- Mass (Da)39,649
- Last updated2009-09-01 v3
- ChecksumFB9ED2440C4EC9AB
Q96EE3-1
- NameB
- SynonymsSEH1B
- Differences from canonical
- 358-360: KHS → YFFTPLDSPRAGSRWSSYAQLLPPPPPPLVEHSCDADTANLQYPHPRRRYLSRPLNPLPENEGI
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 78 | in Ref. 4; BAB71317 | ||||
Sequence: S → P | ||||||
Alternative sequence | VSP_037954 | 358-360 | in isoform B | |||
Sequence: KHS → YFFTPLDSPRAGSRWSSYAQLLPPPPPPLVEHSCDADTANLQYPHPRRRYLSRPLNPLPENEGI |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF255625 EMBL· GenBank· DDBJ | AAM21169.1 EMBL· GenBank· DDBJ | mRNA | ||
AF431970 EMBL· GenBank· DDBJ | AAM44214.1 EMBL· GenBank· DDBJ | mRNA | ||
AF514996 EMBL· GenBank· DDBJ | AAM76707.1 EMBL· GenBank· DDBJ | mRNA | ||
AF136976 EMBL· GenBank· DDBJ | AAG49437.1 EMBL· GenBank· DDBJ | mRNA | ||
AK056940 EMBL· GenBank· DDBJ | BAB71317.1 EMBL· GenBank· DDBJ | mRNA | ||
AK291226 EMBL· GenBank· DDBJ | BAF83915.1 EMBL· GenBank· DDBJ | mRNA | ||
BC012430 EMBL· GenBank· DDBJ | AAH12430.1 EMBL· GenBank· DDBJ | mRNA |