Q96CA5 · BIRC7_HUMAN
- ProteinBaculoviral IAP repeat-containing protein 7
- GeneBIRC7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids298 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Apoptotic regulator capable of exerting proapoptotic and anti-apoptotic activities and plays crucial roles in apoptosis, cell proliferation, and cell cycle control (PubMed:11024045, PubMed:11084335, PubMed:11162435, PubMed:16729033, PubMed:17294084).
Its anti-apoptotic activity is mediated through the inhibition of CASP3, CASP7 and CASP9, as well as by its E3 ubiquitin-protein ligase activity (PubMed:11024045, PubMed:16729033).
As it is a weak caspase inhibitor, its anti-apoptotic activity is thought to be due to its ability to ubiquitinate DIABLO/SMAC targeting it for degradation thereby promoting cell survival (PubMed:16729033).
May contribute to caspase inhibition, by blocking the ability of DIABLO/SMAC to disrupt XIAP/BIRC4-caspase interactions (PubMed:16729033).
Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine (PubMed:11084335, PubMed:11162435, PubMed:11865055).
Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2 (PubMed:11865055).
This activation depends on TAB1 and MAP3K7/TAK1 (PubMed:11865055).
In vitro, inhibits CASP3 and proteolytic activation of pro-CASP9 (PubMed:11024045).
Its anti-apoptotic activity is mediated through the inhibition of CASP3, CASP7 and CASP9, as well as by its E3 ubiquitin-protein ligase activity (PubMed:11024045, PubMed:16729033).
As it is a weak caspase inhibitor, its anti-apoptotic activity is thought to be due to its ability to ubiquitinate DIABLO/SMAC targeting it for degradation thereby promoting cell survival (PubMed:16729033).
May contribute to caspase inhibition, by blocking the ability of DIABLO/SMAC to disrupt XIAP/BIRC4-caspase interactions (PubMed:16729033).
Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine (PubMed:11084335, PubMed:11162435, PubMed:11865055).
Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2 (PubMed:11865055).
This activation depends on TAB1 and MAP3K7/TAK1 (PubMed:11865055).
In vitro, inhibits CASP3 and proteolytic activation of pro-CASP9 (PubMed:11024045).
Isoform 1
Blocks staurosporine-induced apoptosis (PubMed:11322947).
Promotes natural killer (NK) cell-mediated killing (PubMed:18034418).
Promotes natural killer (NK) cell-mediated killing (PubMed:18034418).
Isoform 2
Blocks etoposide-induced apoptosis (PubMed:11162435, PubMed:11322947).
Protects against natural killer (NK) cell-mediated killing (PubMed:18034418).
Protects against natural killer (NK) cell-mediated killing (PubMed:18034418).
Catalytic activity
Features
Showing features for site, binding site.
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameBaculoviral IAP repeat-containing protein 7
- EC number
- Alternative names
- Cleaved into 1 chains
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96CA5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Nuclear, and in a filamentous pattern throughout the cytoplasm. Full-length livin is detected exclusively in the cytoplasm, whereas the truncated form (tLivin) is found in the peri-nuclear region with marked localization to the Golgi apparatus; the accumulation of tLivin in the nucleus shows positive correlation with the increase in apoptosis.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 87-88 | No change in SMAC interaction and anti-apoptotic activity. | ||||
Sequence: EE → AA | ||||||
Mutagenesis | 120 | Abolishes inhibition of caspases, SMAC binding and anti-apoptotic activity. | ||||
Sequence: D → A | ||||||
Mutagenesis | 124 | Abolishes inhibition of caspases and anti-apoptotic activity. | ||||
Sequence: C → A | ||||||
Mutagenesis | 138 | Abolishes inhibition of caspases, SMAC binding and anti-apoptotic activity. | ||||
Sequence: D → A | ||||||
Natural variant | VAR_020253 | 223 | in dbSNP:rs1077019 | |||
Sequence: E → Q |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 370 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000122362 | 1-298 | UniProt | Baculoviral IAP repeat-containing protein 7 | |||
Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS | |||||||
Modified residue (large scale data) | 37 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Chain | PRO_0000416092 | 53-298 | UniProt | Baculoviral IAP repeat-containing protein 7 30kDa subunit | |||
Sequence: GQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS | |||||||
Modified residue (large scale data) | 220 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Autoubiquitinated and undergoes proteasome-mediated degradation.
The truncated protein (tLivin) not only loses its anti-apoptotic effect but also acquires a pro-apoptotic effect.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Isoform 1 and isoform 2 are expressed at very low levels or not detectable in most adult tissues. Detected in adult heart, placenta, lung, lymph node, spleen and ovary, and in several carcinoma cell lines. Isoform 2 is detected in fetal kidney, heart and spleen, and at lower levels in adult brain, skeletal muscle and peripheral blood leukocytes.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Binds to CASP9. Interaction with DIABLO/SMAC via the BIR domain disrupts binding to CASP9 and apoptotic suppressor activity. Interacts with TAB1. In vitro, interacts with CASP3 and CASP7 via its BIR domain.
Binary interactions
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, repeat, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-32 | Disordered | ||||
Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGP | ||||||
Repeat | 90-155 | BIR | ||||
Sequence: RLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLL | ||||||
Region | 176-221 | Disordered | ||||
Sequence: SWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSP | ||||||
Zinc finger | 252-286 | RING-type | ||||
Sequence: CKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICR |
Domain
The RING domain is essential for autoubiquitination.
Sequence similarities
Belongs to the IAP family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q96CA5-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name2
- SynonymsLivin alpha
- Length298
- Mass (Da)32,798
- Last updated2002-07-11 v2
- ChecksumB2EAAEE531BEC101
Q96CA5-2
- Name1
- SynonymsLivin beta
- Differences from canonical
- 216-233: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A8MTF4 | A8MTF4_HUMAN | BIRC7 | 193 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_002459 | 216-233 | in isoform 1 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF301009 EMBL· GenBank· DDBJ | AAG37878.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ309298 EMBL· GenBank· DDBJ | CAC37337.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ309298 EMBL· GenBank· DDBJ | CAC37338.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF311388 EMBL· GenBank· DDBJ | AAG33622.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358835 EMBL· GenBank· DDBJ | AAQ89194.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358836 EMBL· GenBank· DDBJ | AAQ89195.1 EMBL· GenBank· DDBJ | mRNA | ||
AL121827 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC014475 EMBL· GenBank· DDBJ | AAH14475.1 EMBL· GenBank· DDBJ | mRNA |