Q96B96 · LDAF1_HUMAN
- ProteinLipid droplet assembly factor 1
- GeneLDAF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids161 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays an important role in the formation of lipid droplets (LD) which are storage organelles at the center of lipid and energy homeostasis (PubMed:31708432).
In association with BSCL2/seipin, defines the sites of LD formation in the endoplasmic reticulum (PubMed:31708432).
In association with BSCL2/seipin, defines the sites of LD formation in the endoplasmic reticulum (PubMed:31708432).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | lipid droplet | |
Biological Process | lipid droplet formation |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLipid droplet assembly factor 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ96B96
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Note: Co-localizes with BSCL2/seipin in the ER, upon LD formation dissociates from BSCL2/seipin and relocalizes to LD surfaces during LD maturation.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-43 | Cytoplasmic | ||||
Sequence: MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQ | ||||||
Transmembrane | 44-61 | Helical | ||||
Sequence: YLDSHPFLAFTLLVFIVM | ||||||
Topological domain | 62-67 | Lumenal | ||||
Sequence: SAVPVG | ||||||
Transmembrane | 68-87 | Helical | ||||
Sequence: FFLLIVVLTTLAALLGVIIL | ||||||
Topological domain | 88-93 | Cytoplasmic | ||||
Sequence: EGLVIS | ||||||
Transmembrane | 94-110 | Helical | ||||
Sequence: VGGFSLLCILCGLGFVS | ||||||
Topological domain | 111-116 | Lumenal | ||||
Sequence: LAMSGM | ||||||
Transmembrane | 117-133 | Helical | ||||
Sequence: MIASYVVVSSLISCWFS | ||||||
Topological domain | 134-161 | Cytoplasmic | ||||
Sequence: PRPLTQQNTSCDFLPAMKSAEFEGLYQE |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_057765 | 97 | in dbSNP:rs35345508 | |||
Sequence: F → L | ||||||
Natural variant | VAR_030923 | 107 | in dbSNP:rs1046480 | |||
Sequence: G → S | ||||||
Natural variant | VAR_030924 | 154 | in dbSNP:rs1063087 | |||
Sequence: E → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 196 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000279535 | 1-161 | UniProt | Lipid droplet assembly factor 1 | |||
Sequence: MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIVMSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIASYVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSAEFEGLYQE | |||||||
Modified residue (large scale data) | 143 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed at high levels in the heart and skeletal muscle. Expressed at low levels in kidney, small intestine, lung and liver.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with isoform 1 and isoform 3 of BSCL2/seipin to form an oligomeric complex.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q96B96 | CACFD1 Q9UGQ2 | 4 | EBI-7055862, EBI-8652492 | |
BINARY | Q96B96 | COQ8A Q8NI60 | 8 | EBI-7055862, EBI-745535 | |
BINARY | Q96B96 | GAD2 Q05329 | 6 | EBI-7055862, EBI-9304251 | |
BINARY | Q96B96 | S100B A8MRB1 | 3 | EBI-7055862, EBI-16432654 | |
BINARY | Q96B96 | SEC22A Q96IW7 | 3 | EBI-7055862, EBI-8652744 | |
BINARY | Q96B96 | SLC48A1 Q6P1K1 | 3 | EBI-7055862, EBI-1222191 | |
BINARY | Q96B96 | SYT16 Q17RD7 | 3 | EBI-7055862, EBI-10238936 | |
BINARY | Q96B96 | TMEM19 Q96HH6 | 3 | EBI-7055862, EBI-741829 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q96B96-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length161
- Mass (Da)17,522
- Last updated2010-11-30 v2
- Checksum196B502EE203BA7E
Q96B96-2
- Name2
- Differences from canonical
- 30-30: N → NSKLPQHSRISLDSDDGVSRLGSAG
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_056078 | 30 | in isoform 2 | |||
Sequence: N → NSKLPQHSRISLDSDDGVSRLGSAG |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY212918 EMBL· GenBank· DDBJ | AAO52682.1 EMBL· GenBank· DDBJ | mRNA | ||
AK074667 EMBL· GenBank· DDBJ | BAC11122.1 EMBL· GenBank· DDBJ | mRNA | ||
AK293557 EMBL· GenBank· DDBJ | BAG57032.1 EMBL· GenBank· DDBJ | mRNA | ||
AF001550 EMBL· GenBank· DDBJ | AAB67598.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC008551 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC015812 EMBL· GenBank· DDBJ | AAH15812.1 EMBL· GenBank· DDBJ | mRNA |