Q969X1 · LFG3_HUMAN
- ProteinProtein lifeguard 3
- GeneTMBIM1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids311 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Negatively regulates aortic matrix metalloproteinase-9 (MMP9) production and may play a protective role in vascular remodeling.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | endosome membrane | |
Cellular Component | extracellular exosome | |
Cellular Component | Golgi apparatus | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | lysosomal membrane | |
Cellular Component | membrane | |
Cellular Component | plasma membrane | |
Cellular Component | specific granule membrane | |
Molecular Function | death receptor binding | |
Biological Process | negative regulation of apoptotic signaling pathway | |
Biological Process | negative regulation of catalytic activity | |
Biological Process | negative regulation of extrinsic apoptotic signaling pathway via death domain receptors | |
Biological Process | negative regulation of Fas signaling pathway | |
Biological Process | negative regulation of protein localization to plasma membrane | |
Biological Process | positive regulation of blood vessel remodeling |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProtein lifeguard 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ969X1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 110-130 | Helical | ||||
Sequence: LLITVAIIAIFTFVEPVSAFV | ||||||
Transmembrane | 134-154 | Helical | ||||
Sequence: VAVYYVSYAVFVVTYLILACC | ||||||
Transmembrane | 165-185 | Helical | ||||
Sequence: IILLTLFTFAMGFMTGTISSM | ||||||
Transmembrane | 190-210 | Helical | ||||
Sequence: AVIIAMIITAVVSISVTIFCF | ||||||
Transmembrane | 221-241 | Helical | ||||
Sequence: GLFCVLGIVLLVTGIVTSIVL | ||||||
Transmembrane | 246-266 | Helical | ||||
Sequence: VYWLHMLYAALGAICFTLFLA | ||||||
Transmembrane | 286-306 | Helical | ||||
Sequence: ITGALQIYTDIIYIFTFVLQL |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_017382 | 21 | in dbSNP:rs2292553 | |||
Sequence: P → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 372 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000179090 | 1-311 | UniProt | Protein lifeguard 3 | |||
Sequence: MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIFTFVLQLMGDRN | |||||||
Modified residue (large scale data) | 2 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 81 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 81 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 83 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 83 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q969X1 | B3GALNT2 Q8NCR0 | 3 | EBI-2820569, EBI-12934759 | |
BINARY | Q969X1 | BIK Q13323 | 3 | EBI-2820569, EBI-700794 | |
BINARY | Q969X1 | CD33 P20138 | 3 | EBI-2820569, EBI-3906571 | |
BINARY | Q969X1 | GGT6 Q6P531 | 3 | EBI-2820569, EBI-2868927 | |
BINARY | Q969X1 | PROK2 Q9HC23 | 3 | EBI-2820569, EBI-13045372 | |
BINARY | Q969X1 | RIC3 Q7Z5B4-5 | 3 | EBI-2820569, EBI-12375429 | |
BINARY | Q969X1 | SLC10A1 Q14973 | 3 | EBI-2820569, EBI-3923031 | |
BINARY | Q969X1 | TMEM242 Q9NWH2 | 3 | EBI-2820569, EBI-10315004 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-28 | Pro residues | ||||
Sequence: MSNPSAPPPYEDRNPLYPGPPPPGGYGQ | ||||||
Region | 1-37 | Disordered | ||||
Sequence: MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYP | ||||||
Compositional bias | 50-65 | Pro residues | ||||
Sequence: PAGYPQPMPPTHPMPM | ||||||
Region | 50-72 | Disordered | ||||
Sequence: PAGYPQPMPPTHPMPMNYGPGHG |
Sequence similarities
Belongs to the BI1 family. LFG subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length311
- Mass (Da)34,607
- Last updated2006-03-07 v2
- Checksum12B5741A60C1487F
Computationally mapped potential isoform sequences
There are 15 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
C9IZ27 | C9IZ27_HUMAN | TMBIM1 | 150 | ||
C9IYT2 | C9IYT2_HUMAN | TMBIM1 | 107 | ||
F8WDY4 | F8WDY4_HUMAN | TMBIM1 | 140 | ||
C9JWV9 | C9JWV9_HUMAN | TMBIM1 | 171 | ||
C9JW19 | C9JW19_HUMAN | TMBIM1 | 167 | ||
B4DUD2 | B4DUD2_HUMAN | TMBIM1 | 215 | ||
C9JN47 | C9JN47_HUMAN | TMBIM1 | 73 | ||
C9JM62 | C9JM62_HUMAN | TMBIM1 | 46 | ||
C9JI44 | C9JI44_HUMAN | TMBIM1 | 84 | ||
C9JEN3 | C9JEN3_HUMAN | TMBIM1 | 106 | ||
C9JDV0 | C9JDV0_HUMAN | TMBIM1 | 90 | ||
C9JAK9 | C9JAK9_HUMAN | TMBIM1 | 67 | ||
C9JAP5 | C9JAP5_HUMAN | TMBIM1 | 91 | ||
B3KSM0 | B3KSM0_HUMAN | TMBIM1 | 137 | ||
A0A1D5RMQ2 | A0A1D5RMQ2_HUMAN | TMBIM1 | 8 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-28 | Pro residues | ||||
Sequence: MSNPSAPPPYEDRNPLYPGPPPPGGYGQ | ||||||
Compositional bias | 50-65 | Pro residues | ||||
Sequence: PAGYPQPMPPTHPMPM | ||||||
Sequence conflict | 119 | in Ref. 1; BAC04516 | ||||
Sequence: I → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK027755 EMBL· GenBank· DDBJ | BAB55346.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK090618 EMBL· GenBank· DDBJ | BAG52198.1 EMBL· GenBank· DDBJ | mRNA | ||
AK095270 EMBL· GenBank· DDBJ | BAC04516.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AF193045 EMBL· GenBank· DDBJ | AAG22473.1 EMBL· GenBank· DDBJ | mRNA | ||
AK075465 EMBL· GenBank· DDBJ | BAC11636.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
CH471063 EMBL· GenBank· DDBJ | EAW70607.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC007980 EMBL· GenBank· DDBJ | AAH07980.1 EMBL· GenBank· DDBJ | mRNA | ||
BC013428 EMBL· GenBank· DDBJ | AAH13428.1 EMBL· GenBank· DDBJ | mRNA | ||
BC026348 EMBL· GenBank· DDBJ | AAH26348.1 EMBL· GenBank· DDBJ | mRNA | ||
BC026693 EMBL· GenBank· DDBJ | AAH26693.1 EMBL· GenBank· DDBJ | mRNA | Frameshift |