Q969M3 · YIPF5_HUMAN
- ProteinProtein YIPF5
- GeneYIPF5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids257 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in transport between endoplasmic reticulum and Golgi. In pancreatic beta cells, required to transport proinsulin from endoplasmic reticulum into the Golgi (PubMed:33164986).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COPII-coated ER to Golgi transport vesicle | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum exit site | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | Golgi apparatus | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | nucleoplasm | |
Cellular Component | trans-Golgi network | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | insulin processing | |
Biological Process | protein transport | |
Biological Process | regulation of ER to Golgi vesicle-mediated transport | |
Biological Process | vesicle fusion with Golgi apparatus |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein YIPF5
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ969M3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Golgi apparatus, cis-Golgi network membrane ; Multi-pass membrane protein
Note: Enriched at the endoplasmic reticulum exit sites (By similarity).
Incorporated into COPII-coated vesicles (By similarity).
Incorporated into COPII-coated vesicles (By similarity).
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-124 | Cytoplasmic | ||||
Sequence: MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNE | ||||||
Transmembrane | 125-145 | Helical | ||||
Sequence: TDLAGPMVFCLAFGATLLLAG | ||||||
Topological domain | 146 | Lumenal | ||||
Sequence: K | ||||||
Transmembrane | 147-167 | Helical | ||||
Sequence: IQFGYVYGISAIGCLGMFCLL | ||||||
Topological domain | 168-173 | Cytoplasmic | ||||
Sequence: NLMSMT | ||||||
Transmembrane | 174-194 | Helical | ||||
Sequence: GVSFGCVASVLGYCLLPMILL | ||||||
Topological domain | 195-196 | Lumenal | ||||
Sequence: SS | ||||||
Transmembrane | 197-217 | Helical | ||||
Sequence: FAVIFSLQGMVGIILTAGIIG | ||||||
Topological domain | 218-236 | Cytoplasmic | ||||
Sequence: WCSFSASKIFISALAMEGQ | ||||||
Transmembrane | 237-257 | Helical | ||||
Sequence: QLLVAYPCALLYGVFALISVF |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Microcephaly, epilepsy, and diabetes syndrome 2 (MEDS2)
- Note
- DescriptionAn autosomal recessive disorder characterized by neonatal or early-onset diabetes, severe microcephaly, and epilepsy.
- See alsoMIM:619278
Natural variants in MEDS2
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_085533 | 97 | G>V | in MEDS2; uncertain significance | |
VAR_085534 | 98 | I>S | in MEDS2; no effect on differentiation and function of pancreatic beta cells; increased endoplasmic reticulum stress-induced apoptosis; decreased in C-peptide levels associated with increased proinsulin accumulation | |
VAR_085535 | 106 | missing | in MEDS2; uncertain significance | |
VAR_085536 | 181 | A>V | in MEDS2; uncertain significance | |
VAR_085537 | 218 | W>R | in MEDS2; uncertain significance |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_085533 | 97 | in MEDS2; uncertain significance | |||
Sequence: G → V | ||||||
Natural variant | VAR_085534 | 98 | in MEDS2; no effect on differentiation and function of pancreatic beta cells; increased endoplasmic reticulum stress-induced apoptosis; decreased in C-peptide levels associated with increased proinsulin accumulation | |||
Sequence: I → S | ||||||
Natural variant | VAR_085535 | 106 | in MEDS2; uncertain significance | |||
Sequence: Missing | ||||||
Natural variant | VAR_085536 | 181 | in MEDS2; uncertain significance | |||
Sequence: A → V | ||||||
Natural variant | VAR_085537 | 218 | in MEDS2; uncertain significance | |||
Sequence: W → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 282 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000234328 | 1-257 | UniProt | Protein YIPF5 | |||
Sequence: MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLVAYPCALLYGVFALISVF | |||||||
Modified residue (large scale data) | 42 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 45 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitously expressed with abundant expression in pancreatic tissue, islets, beta cells, and brain. Highly expressed in coronary smooth muscles.
Induction
By TGFB1.
Developmental stage
Expressed in developing cortex at all stages examined but most strikingly at 12 gestational weeks. Expression is found in both progenitor (ventricular zone) and neuronal (intermediate zone and cortical plate) compartments. Also selectively expressed within the choroid plexus within the cerebral ventricles.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with the COPII coat components Sec23 (SEC23A and/or SEC23B) and Sec24 (SEC24A and/or SEC24B) (PubMed:11489904).
Interacts with YIF1A (PubMed:15990086).
May interact with RAB1A (PubMed:15611160).
Interacts with YIPF3 and YIPF4 (PubMed:27999994).
Interacts with YIF1A (PubMed:15990086).
May interact with RAB1A (PubMed:15611160).
Interacts with YIPF3 and YIPF4 (PubMed:27999994).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q969M3 | ERN1 O75460 | 3 | EBI-2124787, EBI-371750 | |
BINARY | Q969M3 | YIF1A O95070 | 9 | EBI-2124787, EBI-2799703 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 75-106 | Interaction with Sec23 | ||||
Sequence: PASPQPFYGNNFEDEPPLLEELGINFDHIWQK |
Sequence similarities
Belongs to the YIP1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q969M3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length257
- Mass (Da)27,989
- Last updated2001-12-01 v1
- ChecksumB30EACB0E514DC67
Q969M3-2
- Name2
- SynonymsD
- Differences from canonical
- 1-54: Missing
Q969M3-3
- Name3
- SynonymsI
- Differences from canonical
- 242-257: YPCALLYGVFALISVF → LQPNITYGSNYFLFCCLPYPQQHF
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_018253 | 1-54 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 136-138 | in Ref. 3; AAK67644 | ||||
Sequence: AFG → DLA | ||||||
Sequence conflict | 155 | in Ref. 1; AAG48521 | ||||
Sequence: I → S | ||||||
Sequence conflict | 187 | in Ref. 3; AAK67644 | ||||
Sequence: C → W | ||||||
Sequence conflict | 192 | in Ref. 1; AAG48521 | ||||
Sequence: I → Y | ||||||
Alternative sequence | VSP_018254 | 242-257 | in isoform 3 | |||
Sequence: YPCALLYGVFALISVF → LQPNITYGSNYFLFCCLPYPQQHF | ||||||
Sequence conflict | 244 | in Ref. 7; BAD97235 | ||||
Sequence: C → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF140225 EMBL· GenBank· DDBJ | AAG48521.1 EMBL· GenBank· DDBJ | mRNA | ||
AY640925 EMBL· GenBank· DDBJ | AAV51256.1 EMBL· GenBank· DDBJ | mRNA | ||
AY640926 EMBL· GenBank· DDBJ | AAV51257.1 EMBL· GenBank· DDBJ | mRNA | ||
AY640927 EMBL· GenBank· DDBJ | AAV51258.1 EMBL· GenBank· DDBJ | mRNA | ||
AY640928 EMBL· GenBank· DDBJ | AAV51259.1 EMBL· GenBank· DDBJ | mRNA | ||
AY640929 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AY640934 EMBL· GenBank· DDBJ | AAV51260.1 EMBL· GenBank· DDBJ | mRNA | ||
AY037152 EMBL· GenBank· DDBJ | AAK67644.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358863 EMBL· GenBank· DDBJ | AAQ89222.1 EMBL· GenBank· DDBJ | mRNA | ||
AK054576 EMBL· GenBank· DDBJ | BAB70763.1 EMBL· GenBank· DDBJ | mRNA | ||
AF318329 EMBL· GenBank· DDBJ | AAL55836.1 EMBL· GenBank· DDBJ | mRNA | ||
AK223515 EMBL· GenBank· DDBJ | BAD97235.1 EMBL· GenBank· DDBJ | mRNA | ||
CR749463 EMBL· GenBank· DDBJ | CAH18295.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471062 EMBL· GenBank· DDBJ | EAW61864.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471062 EMBL· GenBank· DDBJ | EAW61865.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC007829 EMBL· GenBank· DDBJ | AAH07829.1 EMBL· GenBank· DDBJ | mRNA | ||
BC014253 EMBL· GenBank· DDBJ | AAH14253.1 EMBL· GenBank· DDBJ | mRNA | ||
BC024737 EMBL· GenBank· DDBJ | AAH24737.1 EMBL· GenBank· DDBJ | mRNA | ||
AB014733 EMBL· GenBank· DDBJ | BAB20270.1 EMBL· GenBank· DDBJ | mRNA |